Back to Multiple platform build/check report for BioC 3.23:   simplified   long
ABCDEFGH[I]JKLMNOPQRSTUVWXYZ

This page was generated on 2026-01-16 11:11 -0500 (Fri, 16 Jan 2026).

HostnameOSArch (*)R versionInstalled pkgs
nebbiolo1Linux (Ubuntu 24.04.3 LTS)x86_64R Under development (unstable) (2025-12-22 r89219) -- "Unsuffered Consequences" 4849
kjohnson3macOS 13.7.7 Venturaarm64R Under development (unstable) (2025-11-04 r88984) -- "Unsuffered Consequences" 4628
Click on any hostname to see more info about the system (e.g. compilers)      (*) as reported by 'uname -p', except on Windows and Mac OS X

Package 1048/2343HostnameOS / ArchINSTALLBUILDCHECKBUILD BIN
immunogenViewer 1.5.0  (landing page)
Katharina Waury
Snapshot Date: 2026-01-15 13:40 -0500 (Thu, 15 Jan 2026)
git_url: https://git.bioconductor.org/packages/immunogenViewer
git_branch: devel
git_last_commit: 24aec9b
git_last_commit_date: 2025-10-29 11:31:16 -0500 (Wed, 29 Oct 2025)
nebbiolo1Linux (Ubuntu 24.04.3 LTS) / x86_64  OK    OK    OK  UNNEEDED, same version is already published
kjohnson3macOS 13.7.7 Ventura / arm64  OK    OK    OK    OK  UNNEEDED, same version is already published


CHECK results for immunogenViewer on nebbiolo1

To the developers/maintainers of the immunogenViewer package:
- Allow up to 24 hours (and sometimes 48 hours) for your latest push to git@git.bioconductor.org:packages/immunogenViewer.git to reflect on this report. See Troubleshooting Build Report for more information.
- Use the following Renviron settings to reproduce errors and warnings.
- If 'R CMD check' started to fail recently on the Linux builder(s) over a missing dependency, add the missing dependency to 'Suggests:' in your DESCRIPTION file. See Renviron.bioc for more information.

raw results


Summary

Package: immunogenViewer
Version: 1.5.0
Command: /home/biocbuild/bbs-3.23-bioc/R/bin/R CMD check --install=check:immunogenViewer.install-out.txt --library=/home/biocbuild/bbs-3.23-bioc/R/site-library --timings immunogenViewer_1.5.0.tar.gz
StartedAt: 2026-01-16 00:49:17 -0500 (Fri, 16 Jan 2026)
EndedAt: 2026-01-16 00:52:02 -0500 (Fri, 16 Jan 2026)
EllapsedTime: 165.2 seconds
RetCode: 0
Status:   OK  
CheckDir: immunogenViewer.Rcheck
Warnings: 0

Command output

##############################################################################
##############################################################################
###
### Running command:
###
###   /home/biocbuild/bbs-3.23-bioc/R/bin/R CMD check --install=check:immunogenViewer.install-out.txt --library=/home/biocbuild/bbs-3.23-bioc/R/site-library --timings immunogenViewer_1.5.0.tar.gz
###
##############################################################################
##############################################################################


* using log directory ‘/home/biocbuild/bbs-3.23-bioc/meat/immunogenViewer.Rcheck’
* using R Under development (unstable) (2025-12-22 r89219)
* using platform: x86_64-pc-linux-gnu
* R was compiled by
    gcc (Ubuntu 13.3.0-6ubuntu2~24.04) 13.3.0
    GNU Fortran (Ubuntu 13.3.0-6ubuntu2~24.04) 13.3.0
* running under: Ubuntu 24.04.3 LTS
* using session charset: UTF-8
* checking for file ‘immunogenViewer/DESCRIPTION’ ... OK
* checking extension type ... Package
* this is package ‘immunogenViewer’ version ‘1.5.0’
* package encoding: UTF-8
* checking package namespace information ... OK
* checking package dependencies ... OK
* checking if this is a source package ... OK
* checking if there is a namespace ... OK
* checking for hidden files and directories ... OK
* checking for portable file names ... OK
* checking for sufficient/correct file permissions ... OK
* checking whether package ‘immunogenViewer’ can be installed ... OK
* checking installed package size ... OK
* checking package directory ... OK
* checking ‘build’ directory ... OK
* checking DESCRIPTION meta-information ... OK
* checking top-level files ... OK
* checking for left-over files ... OK
* checking index information ... OK
* checking package subdirectories ... OK
* checking code files for non-ASCII characters ... OK
* checking R files for syntax errors ... OK
* checking whether the package can be loaded ... OK
* checking whether the package can be loaded with stated dependencies ... OK
* checking whether the package can be unloaded cleanly ... OK
* checking whether the namespace can be loaded with stated dependencies ... OK
* checking whether the namespace can be unloaded cleanly ... OK
* checking loading without being on the library search path ... OK
* checking dependencies in R code ... NOTE
Namespaces in Imports field not imported from:
  ‘httr’ ‘jsonlite’
  All declared Imports should be used.
* checking S3 generic/method consistency ... OK
* checking replacement functions ... OK
* checking foreign function calls ... OK
* checking R code for possible problems ... NOTE
addImmunogensToPlot: no visible binding for global variable ‘xmin’
addImmunogensToPlot: no visible binding for global variable ‘xmax’
addImmunogensToPlot: no visible binding for global variable ‘ymin’
addImmunogensToPlot: no visible binding for global variable ‘ymax’
addImmunogensToPlot: no visible binding for global variable ‘x’
addImmunogensToPlot: no visible binding for global variable ‘y’
addImmunogensToPlot: no visible binding for global variable ‘label’
plotAccessibility: no visible binding for global variable
  ‘SolventAccessibility’
plotSecondaryStructure: no visible binding for global variable
  ‘SecondaryStructure’
plotSinglePositions: no visible binding for global variable ‘Location’
plotSinglePositions: no visible binding for global variable ‘y’
Undefined global functions or variables:
  Location SecondaryStructure SolventAccessibility label x xmax xmin y
  ymax ymin
* checking Rd files ... OK
* checking Rd metadata ... OK
* checking Rd cross-references ... OK
* checking for missing documentation entries ... OK
* checking for code/documentation mismatches ... OK
* checking Rd \usage sections ... OK
* checking Rd contents ... OK
* checking for unstated dependencies in examples ... OK
* checking files in ‘vignettes’ ... OK
* checking examples ... OK
* checking for unstated dependencies in ‘tests’ ... OK
* checking tests ...
  Running ‘testthat.R’
 OK
* checking for unstated dependencies in vignettes ... OK
* checking package vignettes ... OK
* checking re-building of vignette outputs ... OK
* checking PDF version of manual ... OK
* DONE

Status: 2 NOTEs
See
  ‘/home/biocbuild/bbs-3.23-bioc/meat/immunogenViewer.Rcheck/00check.log’
for details.


Installation output

immunogenViewer.Rcheck/00install.out

##############################################################################
##############################################################################
###
### Running command:
###
###   /home/biocbuild/bbs-3.23-bioc/R/bin/R CMD INSTALL immunogenViewer
###
##############################################################################
##############################################################################


* installing to library ‘/home/biocbuild/bbs-3.23-bioc/R/site-library’
* installing *source* package ‘immunogenViewer’ ...
** this is package ‘immunogenViewer’ version ‘1.5.0’
** using staged installation
** R
** inst
** byte-compile and prepare package for lazy loading
** help
*** installing help indices
** building package indices
** installing vignettes
** testing if installed package can be loaded from temporary location
** testing if installed package can be loaded from final location
** testing if installed package keeps a record of temporary installation path
* DONE (immunogenViewer)

Tests output

immunogenViewer.Rcheck/tests/testthat.Rout


R Under development (unstable) (2025-12-22 r89219) -- "Unsuffered Consequences"
Copyright (C) 2025 The R Foundation for Statistical Computing
Platform: x86_64-pc-linux-gnu

R is free software and comes with ABSOLUTELY NO WARRANTY.
You are welcome to redistribute it under certain conditions.
Type 'license()' or 'licence()' for distribution details.

R is a collaborative project with many contributors.
Type 'contributors()' for more information and
'citation()' on how to cite R or R packages in publications.

Type 'demo()' for some demos, 'help()' for on-line help, or
'help.start()' for an HTML browser interface to help.
Type 'q()' to quit R.

> # This file is part of the standard setup for testthat.
> # It is recommended that you do not modify it.
> #
> # Where should you do additional test configuration?
> # Learn more about the roles of various files in:
> # * https://r-pkgs.org/testing-design.html#sec-tests-files-overview
> # * https://testthat.r-lib.org/articles/special-files.html
> 
> library(testthat)
> library(immunogenViewer)
> 
> test_check("immunogenViewer")
[1] "Immunogen name: A12"
[1] "Immunogen sequence: GHLFAINYTGASMNPARSFGPAVIMGNWENH (Residues 200 - 230)"
[1] "No immunogen specified, evaluating all immunogens."
[1] "Immunogen name: A12"
[1] "Immunogen sequence: GHLFAINYTGASMNPARSFGPAVIMGNWENH (Residues 200 - 230)"
[ FAIL 0 | WARN 0 | SKIP 0 | PASS 39 ]
> 
> proc.time()
   user  system elapsed 
 10.169   0.719  28.819 

Example timings

immunogenViewer.Rcheck/immunogenViewer-Ex.timings

nameusersystemelapsed
addImmunogen0.1450.0091.712
addImmunogenList0.1130.0162.093
evaluateImmunogen0.1150.0111.880
getProteinFeatures0.1180.0252.041
plotImmunogen1.4300.1033.443
plotProtein1.1450.1381.982
removeImmunogen0.0780.0051.758
renameImmunogen0.1260.0011.964