mariadb-client-10.11.9-150600.4.6.1<>,fp9|-OI&ܴïR :aK#⋈lmhN`ͯ#a)v2k(%I`AvpLwf[` ѥ戒bMNWZhpXZ)VhP&l|VsMAtgH+` ȶ*,D@8S%?^={?i"'owEuk^=\`r㢶9[-׉N0t{ 4/HRNi1I. gj>FT?Td & 9tx 17>!@! ! ! H!  i!  ! l! !  ! ` $ T$$pt(89: =CBCFCGC!HDP!ID!XDYEZE\[E`\Eh!]E!^GbHFcHdIqeIvfIylI{uI!vJwQ!xR !yRzTTTTTCmariadb-client10.11.9150600.4.6.1Client for MariaDBThis package contains the standard clients for MariaDB.fh01-ch4cSUSE Linux Enterprise 15SUSE LLC SUSE-GPL-2.0-with-FLOSS-exceptionhttps://www.suse.com/Productivity/Databases/Clientshttps://www.mariadb.orglinuxx86_64/usr/sbin/sysusers2shadow mysql-user.conf <<"EOF" || [ -f /.buildenv ] u mysql 60 "MySQL database admin" /var/lib/mysql EOF P8L(LNLPLGy0   Mh))(*($1>}7`9ugAA큤ffffffffffffffffffffffffffftftftftftftftff2618c4242f48e7a984cc0c95bbac507a4732f043e21f140a95cc87c26a093ad59460d698f2c233881d502ecbd8920c1bbbd1d67fa5d8f72441b1525e148c5d291ec6093b3d0bfd96acc804f84919ffb966848697b8708b3891c8350bc2863d50e8628a2bf1628a71a1004177639beb37dbf7da8f268f92a00fdf7ea158da3747916a92ccbf97068b41828d9116a2954a8b95ab1e1583fe1cb1eb99af58f8ac18a12fd462b773deb6cd942d0d13239e601a0d0d975cfcd6cf6fe49018c9feca480599f57a25c6d8527d1848288dd7ad7130accd52e58dbeb573ebad4fd36a01a87316c9cef9d9f3659d257f3e303627db92124d1c80010bb05e6ec853a649eb3ca8ece4659a9e724f8ff4fa607797b31d9dd45af1aa1a508127c9d8b465cebaeb93d85b8e7f0b2f67b6fb8fa6e1a93916e54ff158168f09ba9fbff369c0dc23e1be4318acaa2e00a39edf548e9d5ae129fa7f0dfb66ad1e63b824a6df9f03f44c2ccaa9faf36cf2867e67e2cdf1a1d8ebab0d285930b55da375ae964894a7eea7987e92c69f5547d59d33de9b4724121ceb65f3ff50c5bce5ae6b01fd0a80239c692557c1f2bd8f2e981cae9a934da46e5ac1cf8c57c728c51a53b107f334e71e18157e03db02c9b73c81ac192d173ff85a6847f601493f66f087b76855fe9032d683106781bedcbdca6c0398206fd74191991b8feb11568100b4eee81665e5e8dd90090149be367d766a5b7c37c56b305a14a4ac0429741138a026a3340b61263658e9b2231f75935c9171b3c75a6c27f42d6805137ec6b569202dbdcbee7e79396479f07a9bc83beac587fb65d112a51f04d2696f5809fe76ba8ff0b1446c463d4e95dfbd7d0ab4ed7439ce24a94289dd26a9e923e7d37ba994c3159e53dd306af69ebad50269e536088db23b2e9f33f3f9e201970664babe05be35a53255a5307037f6de37d3126304efc9766ca12aca87f4bcff9c45a17695b596c61cb51ca67bc6b7ccd8baddc0f2e2a95b3c849adbe84cfd27079bc7a6cefd2fe4b51bb214f89960ea87f3f3dd2a052f3c999aef1547c2757474c7b210c22adab597dfmariadbmariadb-adminmariadb-checkmariadbd-safe-helpermariadb-dumpmariadb-importmariadb-showrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmariadb-10.11.9-150600.4.6.1.src.rpmconfig(mariadb-client)group(mysql)mariadb-clientmariadb-client(x86-64)mysql-clientuser(mysql)@@@@@@@@@@@@@@@@@@ @@@@@@@@@     /bin/shconfig(mariadb-client)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.33)(64bit)libc.so.6(GLIBC_2.34)(64bit)libc.so.6(GLIBC_2.38)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcrypto.so.3()(64bit)libcrypto.so.3(OPENSSL_3.0.0)(64bit)libedit.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libmariadb3libncurses.so.6()(64bit)libncurses.so.6(NCURSEST6_5.7.20081102)(64bit)libssl.so.3()(64bit)libssl.so.3(OPENSSL_3.0.0)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libz.so.1()(64bit)mariadb-errormessagesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysuser-shadow10.11.9-150600.4.6.13.010.11.93.0.4-14.6.0-14.0-15.2-13.2mysql-client4.14.3ffU@ee]@e@dd}@dldxc>@c`cj@cwsck@c*c pcM@bb(bw@b'E@b @a͟@a@a@aKaKaW@aba@a~@a^@a]aHwa6a@aG```KW`*b@`@`@_ǁ_#__N7_N7_3_'@^y^א^^Ǿ^@^@^v^y@^V]^U @^U @^O@^=Q@^:@^9\^9\^6^*@^,]@]@]M@]@]p]L]J@]D%]D%]9]8H@]\]@\ڭ\N\@\v{\n\j@\f\eX@\b@\-@\@\w[@[G[t[Q@[9@[[ @[M@[WZ@Z@Z@ZZ@ZH@Z$ZZaZOhZKt@Z;@ZZ@Z@YeYeY@YYcl@Y-^X@X,XpXXbWXAb@X W]NW+5V@V\:@UM@U@U@U>U@UJ@U-@U-@U@U.@T@TPT7T@TT_W@antonio.teixeira@suse.comantonio.teixeira@suse.comdanilo.spinella@suse.comoss@danyspin97.orgdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comchris@computersalat.dedanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comgmbr3@opensuse.orgdanilo.spinella@suse.comdanilo.spinella@suse.comsuse-beta@cboltz.dedanilo.spinella@suse.comjsegitz@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comrpm@fthiessen.dedimstar@opensuse.orgkstreitova@suse.comkstreitova@suse.commrueckert@suse.demrueckert@suse.demrueckert@suse.dekstreitova@suse.commarec@detebe.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgkstreitova@suse.comdimstar@opensuse.orgguillaume.gardet@opensuse.orgpgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comidonmez@suse.commliska@suse.czkukuk@suse.comschwab@suse.depgajdos@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comstefan.bruens@rwth-aachen.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.commliska@suse.czkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comsuse+build@de-korte.orgrick.salevsky@suse.comtbechtold@suse.comnicolas.bock@suse.comkstreitova@suse.comkstreitova@suse.comadrian.glaubitz@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkukuk@suse.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comro@suse.dersalevsky@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.orgkstreitova@suse.comrhafer@suse.devcizek@suse.comkstreitova@suse.comvcizek@suse.combwiedemann@suse.comvcizek@suse.comkstreitova@suse.comfvogt@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.org13ilya@gmail.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichal.hrusecky@opensuse.orgmichal.hrusecky@opensuse.orgdvaleev@suse.comsweet_f_a@gmx.demichal.hrusecky@opensuse.orgmgorse@suse.comxrigou@otenet.grxrigou@otenet.grmichal.hrusecky@opensuse.orgledest@gmail.com- Update to 10.11.9: https://mariadb.com/kb/en/mariadb-10-11-9-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-9-changelog/ * fixes for the following security vulnerabilities: 10.11.9: none - Update list of skipped tests- Update to 10.11.8: https://mariadb.com/kb/en/mariadb-10-11-8-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-8-changelog/ * fixes for the following security vulnerabilities: 10.11.8: CVE-2024-21096 (bsc#1225983) 10.11.7: none - Refreshed patches: * mariadb-10.2.4-fortify-and-O.patch * mariadb-10.2.4-logrotate.patch * mariadb-10.4.12-fix-install-db.patch * mariadb-10.4.12-harden_setuid.patch - Update list of skipped tests- Update list of skipped tests for ppc64le- Update to 10.11.6: https://mariadb.com/kb/en/mariadb-10-11-6-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-6-changelog/ * fixes for the following security vulnerabilities: 10.11:6: CVE-2023-22084, (bsc#1217405) - Refreshed patches: * mariadb-10.4.12-fix-install-db.patch- update the list of the skipped tests for s390x, fix bsc#1215255- Update to 10.11.5: https://mariadb.com/kb/en/mariadb-10-11-5-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-5-changelog/ https://mariadb.com/kb/en/mariadb-10-11-4-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-4-changelog/ * fixes for the following security vulnerabilities: 10.11.5: none 10.11.4: none - Issues that aren't affecting this package: * CVE-2021-46669 * CVE-2022-27376 (bsc#1198628) * CVE-2022-27377 (bsc#1198603) * CVE-2022-27378 (bsc#1198604) * CVE-2022-27379 (bsc#1198605) * CVE-2022-27380 (bsc#1198606) * CVE-2022-27381 (bsc#1198607) * CVE-2022-27382 (bsc#1198609) * CVE-2022-27383 (bsc#1198610) * CVE-2022-27384 (bsc#1198611) * CVE-2022-27386 (bsc#1198612) * CVE-2022-27387 (bsc#1198613) * CVE-2022-27444 (bsc#1198634) * CVE-2022-27445 (bsc#1198629) * CVE-2022-27446 (bsc#1198630) * CVE-2022-27447 (bsc#1198631) * CVE-2022-27448 (bsc#1198632) * CVE-2022-27449 (bsc#1198633) * CVE-2022-27451 (bsc#1198639) * CVE-2022-27452 (bsc#1198640) * CVE-2022-27455 (bsc#1198638) * CVE-2022-27456 (bsc#1198635) * CVE-2022-27457 (bsc#1198636) * CVE-2022-27458 (bsc#1198637) * CVE-2022-32088 (bsc#1201168) * CVE-2022-32087 (bsc#1201167) * CVE-2022-32086 (bsc#1201166) * CVE-2022-32085 (bsc#1201165) * CVE-2022-32083 (bsc#1201163) * CVE-2022-21427 * bsc#1199928 * bsc#1195076 * jsc#SLE-22245- Skip test on s390x to fix build on ALP, bsc#1211859 - Update list of skipped tests- Refresh gcc13-fix.patch - Update to 10.11.3: * release notes and changelog: https://mariadb.com/kb/en/mariadb-10-11-3-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-3-changelog/ * fixes for the following security vulnerabilities: 10.11.3: CVE-2022-47015 (bsc#1207404)- Cherry-pick upstream changes (gcc13-fix.patch) for GCC 13.- Update to 10.11.2: * release notes and changelog: https://mariadb.com/kb/en/changes-improvements-in-mariadb-1011/ https://mariadb.com/kb/en/mariadb-10-11-2-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-2-changelog/ https://mariadb.com/kb/en/mariadb-10-11-1-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-1-changelog/ https://mariadb.com/kb/en/mariadb-10-11-0-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-0-changelog/ - Refresh mariadb-10.2.4-logrotate.patch- Update to 10.10.3: https://mariadb.com/kb/en/mariadb-10-10-3-release-notes/ https://mariadb.com/kb/en/mariadb-10-10-3-changelog/ - Update mariadb.keyring- Update list of skipped tests- Update to 10.10.2: * release notes and changelog: https://mariadb.com/kb/en/changes-improvements-in-mariadb-1010/ https://mariadb.com/kb/en/mariadb-10-10-2-release-notes/ https://mariadb.com/kb/en/mariadb-10-10-2-changelog/ https://mariadb.com/kb/en/mariadb-10101-release-notes/ https://mariadb.com/kb/en/mariadb-10101-changelog/ https://mariadb.com/kb/en/mariadb-10100-release-notes/ * fixes for the following security vulnerabilities: 10.10.2: none- Update to 10.9.4: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1094-release-notes https://mariadb.com/kb/en/library/mariadb-1094-changelog * fixes for the following security vulnerabilities: 10.9.4: none- Update to 10.9.3: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1093-release-notes https://mariadb.com/kb/en/library/mariadb-1093-changelog- Update to 10.9.2: * changes and improvements in MariaDB 10.9: https://mariadb.com/kb/en/changes-improvements-in-mariadb-109/ * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1092-release-notes https://mariadb.com/kb/en/library/mariadb-1092-changelog https://mariadb.com/kb/en/library/mariadb-1091-release-notes https://mariadb.com/kb/en/library/mariadb-1091-changelog https://mariadb.com/kb/en/library/mariadb-1090-release-notes https://mariadb.com/kb/en/library/mariadb-1090-changelog * fixes for the following security vulnerabilities: 10.9.2: CVE-2022-32082 (bsc#1201162) CVE-2022-32089 (bsc#1201169) CVE-2022-32081 (bsc#1201161) CVE-2022-32091 (bsc#1201170) CVE-2022-32084 (bsc#1201164) CVE-2022-38791 (bsc#1202863) * The package is not affected by the following security vulnerabilities: CVE-2018-25032 (bsc#1197459) - Update list of skipped tests- Update mysql-systemd-helper to be aware of custom group, bsc#1200105 - Respect socket setting in mysql-systemd-helper - Fix my_print_defaults call in mysql-system-helper- use the better collation as default * DDEFAULT_COLLATION=utf8mb4_unicode_520_ci- Update list of skipped tests * suse_skipped_tests.list- Update to 10.8.3: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1083-release-notes https://mariadb.com/kb/en/library/mariadb-1083-changelog https://mariadb.com/kb/en/library/mariadb-1082-release-notes https://mariadb.com/kb/en/library/mariadb-1082-changelog https://mariadb.com/kb/en/library/mariadb-1081-release-notes https://mariadb.com/kb/en/library/mariadb-1081-changelog https://mariadb.com/kb/en/library/mariadb-1080-release-notes https://mariadb.com/kb/en/library/mariadb-1080-changelog - Remove upstreamed patch: * bsc1194828.patch- Do not include mariadb-galera files in the main package when %{with galera} is false- Update to 10.7.3 (bsc#1196016): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1073-release-notes https://mariadb.com/kb/en/library/mariadb-1073-changelog https://mariadb.com/kb/en/library/mariadb-1072-release-notes https://mariadb.com/kb/en/library/mariadb-1072-changelog https://mariadb.com/kb/en/library/mariadb-1071-release-notes https://mariadb.com/kb/en/library/mariadb-1071-changelog https://mariadb.com/kb/en/library/mariadb-1070-release-notes https://mariadb.com/kb/en/library/mariadb-1070-changelog * fixes for the following security vulnerabilities: 10.7.3: CVE-2021-46665 CVE-2021-46664 CVE-2021-46661 CVE-2021-46668 CVE-2021-46663 10.7.2: CVE-2022-24052 CVE-2022-24051 CVE-2022-24050 CVE-2022-24048 CVE-2021-46659, bsc#1195339 10.7.1: none 10.7.0: none - Remove upstreamed patches: * mariadb-10.0.15-logrotate-su.patch * mariadb-10.1.1-mysqld_multi-features.patch - Refresh mariadb-10.2.4-logrotate.patch - Update list of skipped tests - Add bsc1194828.patch to fix build with GCC12, fixes bsc#1194828 - The following issues have already been fixed in this package but weren't previously mentioned in the changes file: CVE-2021-46658, bsc#1195334 CVE-2021-46657, bsc#1195325- Build mariadb-galera on SLE - Add dependency on galera-4 for mariadb-galera - Remove old constraints for mariadb-galera- The following issues have already been fixed in this package but weren't previously mentioned in the changes file: bsc#1189320 CVE-2021-2154, bsc#1185872 CVE-2021-2166, bsc#1185870 CVE-2021-27928, bsc#1183770 MDEV-23851- Fix rpmlint errors - Run spec-cleaner- Enable LZ4 compression for INNODB and ROCKSDB, fixes bsc#1186031- Revert systemd hardening * Remove harden_mariadb.service.patch- Add CONFIG parameter to %sysusers_generate_pre- Update to 10.6.5 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1065-release-notes https://mariadb.com/kb/en/library/mariadb-1065-changelog * fixes for the following security vulnerabilities: 10.6.5: none - Not affected by [CVE-2021-35604], bsc#1192497 - Drop upstreamed patch: * mariadb-10.2.19-link-and-enable-c++11-atomics.patch- Use pam macros instead of hardcoding directories, fixes bsc#1191038 - Add fix-pamdir.patch- Add func_math_tests_MDEV-26645.diff to avoid test failures in the func_math test on Tumbleweed s390x and ppc64 until MDEV-26645 gets fixed upstream- Fix socket address in mariadb@.socket file- Added hardening to systemd service(s) (bsc#1181400). Added patch(es): * harden_mariadb.service.patch Modified: * mariadb.service.in- Replace %{_rpmconfigdir}/macros.d with %{_rpmmacrodir}, remove ownership of this directory. Fixes boo#1182218 - Run spec-cleaner- Update to 10.6.4 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1064-release-notes https://mariadb.com/kb/en/library/mariadb-1064-changelog https://mariadb.com/kb/en/library/mariadb-1063-release-notes https://mariadb.com/kb/en/library/mariadb-1063-changelog https://mariadb.com/kb/en/library/mariadb-1062-release-notes https://mariadb.com/kb/en/library/mariadb-1062-changelog https://mariadb.com/kb/en/library/mariadb-1061-release-notes https://mariadb.com/kb/en/library/mariadb-1061-changelog https://mariadb.com/kb/en/library/mariadb-1060-release-notes https://mariadb.com/kb/en/library/mariadb-1060-changelog * fixes for the following security vulnerabilities: 10.6.4: CVE-2021-2372 CVE-2021-2389 - Removed support to tokudb as it has been removed from upstream - Refresh mariadb-10.2.4-fortify-and-O.patch - Add new systemd socket from upstream- Support both rpmlint 1.x and 2.x.- Update rpmlint rules in order to work with rpmlint2 (bsc#1179049).- Update to version 10.5.10 * Fix CVE-2021-2154 * Add ST_DISTANCE_SPHERE for calculating the spherical distance between two geometries (point or multipoint) on a sphere * Fix: Crash with invalid multi-table update of view in 2nd execution of SP * Fix: Incorrect name resolution for subqueries in ON expressions * Fix: Complex query in Store procedure corrupts results * Fix: DELETE HISTORY may delete current data on system-versioned table * Fix: Crashes with nested table value constructors * Fix: Server crashes in thd_clear_errors() * Fix: The statement set password=password('') executed in PS mode fails in case it is run by a user with expired password * Full changes: https://mariadb.com/kb/en/mariadb-10510-changelog/ - Drop mariadb-10.5.9-cmake-3.20.patch, applied upstream- Add mariadb-10.5.9-cmake-3.20.patch: Fix syntax error which is exposed by cmake 3.20.- Update to 10.5.9 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1059-release-notes https://mariadb.com/kb/en/library/mariadb-1059-changelog * fixes for the following security vulnerabilities: 10.5.9: none - Tracker bug: [bsc#1182739] - Update fixes [bsc#1182255] (MDL BF-BF Conflict caused by TRUNCATE TABLE) - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - remove fix-lock-rollback-assert-abort.patch (applied upstream)- update the list of the skipped tests- exclude galera files if we build without this feature. - switch from 664 to 644 for my.cnf configuration file (probably a typo)- added fix-lock-rollback-assert-abort.patch fix an abort when a transaction is rolled back - track all patches in a series so we can easily set up a quilt tree without requiring all the devel packages- switch to bcond_with to make it easier to enable galera support via the prjconfig - fix non galera case for building- Update to 10.5.8 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1058-release-notes https://mariadb.com/kb/en/library/mariadb-1058-changelog * fixes for the following security vulnerabilities: 10.5.7: CVE-2020-14812, CVE-2020-14765, CVE-2020-14776, CVE-2020-14789 10.5.8: none - tracker bugs: [bsc#1177472] and [bsc#1178428] - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - update suse_skipped_tests.list- update to 10.5.6 * release notes and changelog https://mariadb.com/kb/en/mariadb-1056-release-notes https://mariadb.com/kb/en/mariadb-1056-changelog * fixes for the following security vulnerabilities: 10.5.6: CVE-2020-15180 < 10.5.6: none - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - drop mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch - mariadb now builds against pcre2 - added binaries aria_s3_copy and mariadb-conv to tools subpackage - added type_test.type_test_double to list of skipped tests- Using basic.target dependencies is not needed with any systemd release unless DefaultDependencies is disabled, remove from unit files- Mariadb uses hrtimers with absolute CLOCK_REALTIME values, this won't work correctly if the clock isn't set and will do funny things if it goes backward after starting the server as POSIX says that the new clock value shall influence them, start the service after time-sync.target to workaround the problem.- Update to 10.4.14 [bsc#1175596] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10414-release-notes https://mariadb.com/kb/en/library/mariadb-10414-changelog * fixes for the following security vulnerabilities: none * the update fixes [bsc#1174559] and [bsc#1173516] (MariaDB crashes at db_sync from Keystone) - refresh mariadb-10.2.4-fortify-and-O.patch - fix patch sequence - run spec-cleaner - build galera for openSUSE only - update suse_skipped_tests.list - tune the testsuite to avoid randomly failing tests- Fix installed .service files to follow the /usr/lib -> /usr/libexec move (boo#1174811).- Update _constraints to make it more readable and request more memory for aarch64 to avoid occasionnal OOM errors on %check- rpm macros: $TEST_USER identified by $TEST_PASS is actually user of the database for which client conf should be made for - rpm macros: database name or names can be specified as a %mysql_testserver_start and %mysql_testserver_cconf parameter - modified sources % macros.mariadb-test- Build with oqgraph by default for all codestreams [jsc#SLE-12253]- Update to 10.4.13 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10413-release-notes https://mariadb.com/kb/en/library/mariadb-10413-changelog * fixes for the following security vulnerabilities: CVE-2020-2752, CVE-2020-2812, CVE-2020-2814, CVE-2020-2760, CVE-2020-13249 - fixes [bsc#1168380] (the same as [bsc#1166781]) MDEV-21244 mysql_upgrade creating empty global_priv table support upgrades from 5.2 privilege tables - drop specfile "hacks" as things work correctly in upstream now: * renaming tmpfiles.conf -> mariadb.conf * installing pam_user_map.so to /lib64/security for non 32bit architectures * sysusers.conf was renamed to mariadb.conf - update suse_skipped_tests.list- move mariadb-client-test from client subpackage to test subpackage so the symlink from mariadb-client-test -> mysql_client_test works [bsc#1170204]- Add oqgraph.social to the suse_skipped_tests.list (reported upstream as MDEV-22280) [bsc#1169369]- Add -Wl,-Bsymbolic -Wl,-Bsymbolic-functions to linker flags so that symbols are resolved locally if possible, this will avoid https://bugs.kde.org/show_bug.cgi?id=391362- Add mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch in order to fix boo#1158405 (MDEV-21248).- Cleanup mysql user creation/handling and use sysusers.d- Bump disk constraint to 18Gb- test macros: clarify who is admin and user of the database, fix build with 10.4 - modified sources % macros.mariadb-test- remove @VERSION@ from mariadb.service and mariadb@.service- disable testing with rpm macros as it does not work as for 10.4, needs to be investigated- update suse_skipped_tests.list for ppc- rename mariadb.rpmlintrc to mariadb-rpmlintrc - for ppc install pam_user_map.so in /lib/security- rename mariadb-10.2.12-harden_setuid.patch to mariadb-10.4.12-harden_setuid.patch to match the correct version number. - add mariadb-10.4.12-fix-install-db.patch to improve default behaviour of mysql_install_db. This prevents performing security sensitive actions to be performed but instead only warns the caller (bsc#1160868).- update to 10.4.12 [jsc#SLE-8269] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10412-release-notes https://mariadb.com/kb/en/library/mariadb-10412-changelog https://mariadb.com/kb/en/library/mariadb-10411-release-notes https://mariadb.com/kb/en/library/mariadb-10411-changelog * fixes for the following security vulnerabilities: CVE-2020-2574 * don't let mysql_install_db set SUID bit for auth_pam_tool in rpm/deb packages CVE-2020-7221 [bsc#1160868] - add mariadb-10.2.12-harden_setuid.patch to harden auth_pam_tool setuid-root binary [bsc#1160285] - pack pam_user_map.so module in the /%{_lib}/security directory and user_map.conf configuration file in the /etc/security directory - fix race condition with mysql_upgrade_info status file by moving it to the location owned by root (/var/lib/misc) CVE-2019-18901 [bsc#1160895] - move .run-mysql_upgrade file from $datadir/.run-mysql_upgrade to /var/lib/misc/.mariadb_run_upgrade so the mysql user can't use it for a symlink attack [bsc#1160912] - change -DWITH_COMMENT and -DCOMPILATION_COMMENT to be SUSE/openSUSE independent- enhance mariadb.service and mariadb@.service with various options (Documentation=, User=, Group=, KillSignal=, SendSIGKILL=, Restart=, RestartSec=, CapabilityBoundingSet=, ProtectSystem=, ProtectHome=, PermissionsStartOnly= and UMask=) [bsc#1160878] - mysql-systemd-helper: use systemd-tmpfiles instead of shell script operations for a cleaner and safer creating of /run/mysql [bsc#1160883]- update to 10.4.10 * changes and improvements for 10.4 https://mariadb.com/kb/en/changes-improvements-in-mariadb-104/ * fixes for the following security vulnerabilities: none - pack mariadb variants of the mysql binaries (e.g. mariadb-dumpslow is a symlink to mysqldumpslow and the like) - refresh mariadb-10.2.4-fortify-and-O.patch - update suse_skipped_tests.list - _constraints: increase physicalmemory value - package auth_pam_tool setuid binary properly - add cracklib-password-check subpackage but do not build it right now (cracklib-dict-full >= 2.9.0 is not available yet) - add rcmariadb compat link - add mariadb.rpmlintrc file - do not move my_safe_process to bindir but use rpmlint arch-dependent-file-in-usr-share exception for it (this file is used just for the testing and it doesn't have to be in bindir- added rpm test macros: %mysql_testserver_start, %mysql_testserver_cconf, %mysql_testserver_stop First two consuments are python-sortinghat and python-mysqlclient.- update the list of the skipped tests- update to 10.3.20 * notable changes for 10.3.20 * MDEV-20987: InnoDB fails to start when FTS table has FK relation * notable changes for 10.3.19 * MDEV-20864: Debug-only option innodb_change_buffer_dump for dumping the contents of the InnoDB change buffer to the server error log at startup. * MariaBackup: * MDEV-18438: mbstream recreates xtrabackup_info on same directory as backup file * MDEV-20703: mariabackup creates binlog files in serve binlog directory on --prepare --export step * FULLTEXT INDEX: * MDEV-19647: Server hangs after dropping full text indexes and restart * MDEV-19529: InnoDB hang on DROP FULLTEXT INDEX * MDEV-19073: FTS row mismatch after crash recovery * MDEV-20621: FULLTEXT INDEX activity causes InnoDB hang * MDEV-20927: Duplicate key with auto increment * ALTER TABLE: * MDEV-20799: DROP Virtual Column crash * MDEV-20852: BtrBulk is unnecessarily holding dict_index_t::lock * System-Versioned Tables: * MDEV-16210: FK constraints on versioned tables use historical rows, which may cause constraint violation * MDEV-20812: Unexpected ER_ROW_IS_REFERENCED_2 or server crash in row_ins_foreign_report_err upon DELETE from versioned table with FK * Galera wsrep library updated to 25.3.28 * Fixes for the following security vulnerabilities: CVE-2019-2974, CVE-2019-2938 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10320-release-notes https://mariadb.com/kb/en/library/mariadb-10320-changelog https://mariadb.com/kb/en/library/mariadb-10319-release-notes https://mariadb.com/kb/en/library/mariadb-10319-changelog - remove mariadb-10.3.17-fix_ppc_build.patch (applied upstream) - refresh * mariadb-10.2.4-logrotate.patch * mariadb-10.0.15-logrotate-su.patch- update to 10.3.18 * notable changes * Connect updated to Connect 1.06.0010 * MDEV-20066: This bug could cause a table to become corrupt if a column was added instantly * MDEV-15326: A race condition in InnoDB transaction commit that affects record locking was fixed * MDEV-17187: Table doesn't exist in engine after ALTER of FOREIGN KEY * MDEV-20301: InnoDB's MVCC has O(N^2) behaviors * MDEV-18128: Simplify .ibd file creation * MDEV-20060: Failing assertion: srv_log_file_size <= 512ULL << 30 while preparing backup * MDEV-20247: Replication hangs with "preparing" and never starts * MDEV-17614: Remove unnecessary locking for INSERT...ON DUPLICATE KEY UPDATE * MDEV-20311: row_ins_step accesses uninitialized memory * MDEV-19947: Repositories for RHEL 8 ppc64le added * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10318-release-notes https://mariadb.com/kb/en/library/mariadb-10318-changelog- Use instead of for _constraints, increasing the worker pool on x86_64 from 6 to >700.- remove sql_mode from my.ini/my.cnf as NO_ENGINE_SUBSTITUTION and STRICT_TRANS_TABLES are already set by default from version 10.2.4 [bsc#1144314]- add mariadb-10.3.17-fix_ppc_build.patch to fix a compilation failure for ppc if ${CRC32_LIBRARY} target has no COMPILE_FLAGS yet. Then GET_TARGET_PROPERTY returns COMPILE_FLAGS-NOTFOUND, which doesn't work very well when it's later fed back into COMPILE_FLAGS. - _constraints: increase the memory because of the ppc build - adjust mysql-systemd-helper ("shutdown protected MySQL" section) so it checks both ping response and the pid in a process list as it can take some time till the process is terminated. Otherwise it can lead to "found left-over process" situation when regular mariadb is started [bsc#1143215]- update to 10.3.17 [bsc#1141798] * notable changes: * MDEV-19795: Merge upstream MyRocks. * MDEV-17228: Encrypted temporary tables are not encrypted. * MDEV-18328: Disks Plugin is now stable and requires the FILE privilege. * Merge relevant InnoDB changes from MySQL 5.7.27 * Adjust spin loops to the x86 PAUSE instruction latency * CREATE TABLE: MDEV-19292, MDEV-20102 * ALTER TABLE: MDEV-15641, MDEV-19630, MDEV-19916, MDEV-19974 * Indexed virtual columns: MDEV-16222, MDEV-17005, MDEV-19870 * FULLTEXT INDEX: MDEV-14154 * Encryption: MDEV-17228, MDEV-19914 * Galera + FOREIGN KEY: MDEV-19660 * Recovery & Mariabackup: MDEV-19978 * MDEV-19781: Add page id matching check in innochecksum tool * MDEV-20091: DROP TEMPORARY table is logged despite no CREATE was logged * MDEV-19427: mysql_upgrade_service throws exception upgrading from 10.0 to 10.3 * MDEV-19814: Server crash in row_upd_del_mark_clust_rec or Assertion * MDEV-17363: Compressed columns cannot be restored from dump * fixes for the following security vulnerabilities: CVE-2019-2805, CVE-2019-2740, CVE-2019-2739, CVE-2019-2737, CVE-2019-2758 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10317-release-notes https://mariadb.com/kb/en/library/mariadb-10317-changelog - add "BuildRequires: python3" as some tests and myrocks_hotbackup script need python3. Make the PYTHON_SHEBANG value configurable [bsc#1142909] - remove "innodb_file_format" option from my.ini (my.cnf) file that was removed in MariaDB 10.3.1. Also remove "innodb_file_per_table=ON" option that is by default ON and it's redundant now. - remove mariadb-10.2.9-galera_cnf.patch as it's not clear what the correct path to galera wsrep provider is while users can use galera 3, galera 4 or galera compiled on their own - add "Requires: python3-mysqlclient" that is needed by myrocks_hotbackup script- Use FAT LTO objects in order to provide proper static library.- remove client_ed25519.so plugin because it's shipped in mariadb-connector-c package (libmariadb_plugins)- removal of SuSEfirewall2 service, since SuSEfirewall2 has been replaced by firewalld, see [1]. [1]: https://lists.opensuse.org/opensuse-factory/2019-01/msg00490.html- update to 10.3.16 [bsc#1108088] * notable changes: * MDEV-19490: show tables fails when selecting the information_schema database * MDEV-19491: multi-update with triggers and stored routines * MDEV-19541: InnoDB crashes when trying to recover a corrupted page * MDEV-19725: Incorrect error handling in ALTER TABLE * MDEV-19445: FULLTEXT INDEX fix * MDEV-19486: System Versioning fix * MDEV-19509: InnoDB skips the tablespace in rotation list * MDEV-19614: SET GLOBAL innodb_ deadlock due to LOCK_global_system_variables * MDEV-17458: Unable to start galera node * MDEV-17456: Malicious SUPER user can possibly change audit log configuration without leaving traces * MDEV-19588: Wrong results from query, using left join * MDEV-19258: RIGHT JOIN hangs in MariaDB * Virtual columns fixes: MDEV-19027, MDEV-19602 * Crash recovery fixes: MDEV-13080, MDEV-19587, MDEV-19435 * MDEV-11094: Fixed row-based event applying with an error anymore when the events aim at the blackhole engine and row annotation is enabled * MDEV-19076: Fixed slave_parallel_mode=optimistic did not always properly order replication events on temporary tables in some case to attempt execution before a parent event has been already processed * MDEV-19158: Fixed duplicated entries in binlog occurred in combination of LOCK TABLES and binlog_format=MIXED when a being locked table was under replication unsafe operation * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10316-release-notes https://mariadb.com/kb/en/library/mariadb-10316-changelog - fix reading options for multiple instances if my${INSTANCE}.cnf is used. Also remove "umask 077" from mysql-systemd-helper that causes that new datadirs are created with wrong permissions. Set correct permissions for files created by us (mysql_upgrade_info, .run-mysql_upgrade) [bsc#1132666] - remove mariadb-5.5.28-install_db-quiet.patch and add "--rpm" option to the mysql_install_db script that does basically the same [bsc#1080891] - remove mariadb-10.1.12-deharcode-libdir.patch because it's not needed - we don't build libmariadb library in mariadb package anymore so we don't need to take care about LIBDIR and PLUGINDIR here. Moreover we shouldn't (and we don't) touch *_RPM variables as they are internal) [bsc#1080891] - update suse_skipped_tests.list- update to 10.3.15 * see changes in 10.3 series https://mariadb.com/kb/en/library/changes-improvements-in-mariadb-103/ * fixes for the following security vulnerabilities: [CVE-2019-2503] (the rest was already applied for 10.2) - remove mysql-community-server-5.1.45-multi-configuration.patch as we have the same configuration in /etc/my.cnf and it doesn't make any sense to keep it twice. Moreover the patched file support-files/my-medium.cnf.sh was removed in upstream - remove mariadb-5.2.3-cnf.patch as all patched files were removed upstream - refresh mariadb-10.2.4-fortify-and-O.patch - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch and use a simplified version from Debian - refresh README.install and suse-test-run - remove caching_sha2_password.so as it's shipped in mariadb-connector-c package (libmariadb_plugins) - rename libmysqld subpackage (embedded library) to libmariadbd as libmysqld.so was renamed to libmariadbd.so (MDEV-14953) - simplify removing static libs (we don't need to have .static) - add perl(Memoize) and perl(Symbol) to BuildRequires and Requires that are needed for tests - replace Requires pwdutils with shadow - build RocksDB only for x86_64 as other platforms are not supported - remove xtrabackup scripts as we already removed xtrabackup requires and it doesn't work for MariaDB 10.3 anyway - run spec-cleaner - tracker bugs for version updates in between: * 10.2.25 tracker bug [bsc#1136035] * 10.2.29 tracker bug [bsc#1156669]- update to 10.2.24 GA [bsc#1122198] * notable changes: * MDEV-18968 - Both (WHERE 0.1) and (WHERE NOT 0.1) return empty set * MDEV-18466 - Unsafe to log updates on tables referenced by foreign keys with triggers in statement format * MDEV-18899 - Server crashes in Field::set_warning_truncated_wrong_value * MDEV-18298 - Crashes server with segfault during role grants * MDEV-17610 - Unexpected connection abort after certain operations from within stored procedure * MDEV-19112 - WITH clause does not work with information_schema as default database * MDEV-17830 - Server crashes in Item_null_result::field_type upon SELECT with CHARSET(date) and ROLLUP * MDEV-14041 - Server crashes in String::length on queries with functions and ROLLUP * MDEV-18920 - Prepared statements with st_convexhull hang and eat 100% cpu. * MDEV-15837 - Assertion item1->type() == Item::FIELD_ITEM && item2->type() == Item::FIELD_ITEM * MDEV-9531 - GROUP_CONCAT with ORDER BY inside takes a lot of memory while it's executed * MDEV-17036 - BULK with replace doesn't take the first parameter in account * Bug#28986737 - RENAMING AND REPLACING MYSQL.USER TABLE CAN LEAD TO A SERVER CRASH * MDEV-19350 - Server crashes in delete_tree_element / ... / Item_func_group_concat::repack_tree * MDEV-19188 - Server Crash When Using a Trigger With A Number of Virtual Columns on INSERT/UPDATE * MDEV-19352 - Server crash in alloc_histograms_for_table_share upon query from information schema InnoDB * InnoDB persistent corruption fixes: MDEV-19426, MDEV-19022, MDEV-19241, MDEV-13942 * InnoDB recovery fixes and speedup: MDEV-18733, MDEV-12699, MDEV-19356, MDEV-19426 * MDEV-14398 - innodb_encrypt_tables will work even with innodb_encryption_rotate_key_age=0 * MDEV-17036 - BULK with replace doesn't take the first parameter in account * MDEV-14784 - Slave crashes in show_status_array upon running a trigger with select from I_S * MDEV-19060 - mariabackup continues, despite failing to open a tablespace * MDEV-18686 - Add option to PAM authentication plugin to allow case insensitive username matching * bugfix - multi-update checked privileges on views incorrectly * MDEV-19276 - during connect, write error log warning for ER_DBACCESS_DENIED_ERROR, if log_warnings > 1 * MDEV-17456 - Malicious SUPER user can possibly change audit log configuration without leaving traces. * fixes for the following security vulnerabilities: [CVE-2019-2614], [CVE-2019-2627], [CVE-2019-2628] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10224-release-notes https://mariadb.com/kb/en/library/mariadb-10224-changelog - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch- remove %{extra_provides} definition and Provides/Obsoletes where it was used. It's just a remnant and it's no longer needed.- update to 10.2.23 GA * notable changes: * InnoDB ALTER TABLE fixes: MDEV-18016, MDEV-18630, MDEV-18775, MDEV-18732, MDEV-18749, MDEV-18637, MDEV-13818, MDEV-17595 * MDEV-18878: InnoDB Purge: Optimize away futile table lookups * MDEV-14984: Regression in connect performance * MDEV-18936: Purge thread fails to exit on shutdown * MDEV-18272: InnoDB fails to rollback after exceeding FOREIGN KEY recursion depth * MDEV-9519: Data corruption on Galera cluster size change * MDEV-18204: fix incremental MyRocks backup * MDEV-18611: mariabackup terminated while copying InnoDB redo log * MDEV-18669: mariabackup writes timestamp in version line * MDEV-18855: Mariabackup should fetch innodb_compression_level from running server * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10223-release-notes https://mariadb.com/kb/en/library/mariadb-10223-changelog - remove mariadb-10.2.22-fix_path.patch that is no longer needed (applied upstream)- add mariadb-10.2.22-fix_path.patch to fix a path to resolveip in mysql_install_db script [bsc#1127027] MDEV-18526- my.cnf/my.ini: move slow_query_log example to the error log so it's logically together- fix references path below legacy directory /var/run -> /run- remove xtrabackup requirement as MariaDB ships a build in mariabackup so xtrabackup is not needed unless a user specificaly wants to use xtrabackup as sst method (also solves [bsc#1122475]- add slow_query_log example to my.cnf and adjust the logrotate configuration to rotate all /var/log/mysql/*.log files . This is useful when the slow query log is enabled. In that case, this log file should also be rotated (bsc#1112767)- update to 10.2.22 GA * notable changes: * Backport Information Schema CHECK_CONSTRAINTS Table. * MDEV-17475: Maximum value of table_definition_cache is now 2097152 * InnoDB ALTER TABLE fixes: MDEV-16499, MDEV-18186, MDEV-18237, MDEV-18222, MDEV-18256, MDEV-18016, MDEV-16849 * Mariabackup fixes: MDEV-18185, MDEV-18201, MDEV-18194 * Galera crash recovery fix: MDEV-15740 * Encryption fixes: MDEV-18129, MDEV-18183, MDEV-18279 * Fixes for the following security vulnerabilities: * CVE-2019-2510, CVE-2019-2537 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10222-release-notes https://mariadb.com/kb/en/library/mariadb-10222-changelog- update to 10.2.21 GA * notable changes: * MDEV-17589 - Stack-buffer-overflow with indexed varchar (utf8) field * MDEV-16987 - ALTER DATABASE possible in read-only mode (forbid ALTER DATABASE in read_only) * MDEV-17720 - slave_ddl_exec_mode=IDEMPOTENT does not handle DROP DATABASE * MDEV-6453 - Assertion `inited==NONE || (inited==RND && scan)' failed in handler::ha_rnd_init(bool) with InnoDB, joins, AND/OR conditions * MDEV-18105 - Mariabackup fails to copy encrypted InnoDB system tablespace if LSN>4G * MDEV-18041 - Database corruption after renaming a prefix-indexed column [bsc#1120041] * MDEV-17470 - Orphan temporary files after interrupted ALTER cause InnoDB: Operating system error number 17 and eventual fatal error 71 * MDEV-17833: ALTER TABLE is not enforcing prefix index size limit * MDEV-17989: InnoDB: Failing assertion: dict_tf2_is_valid(flags, flags2) * MDEV-17765: Locking bug fix for SPATIAL INDEX * MDEV-17923, MDEV-17904, MDEV-17938: Fixes for FULLTEXT INDEX * Fixes for regressions introduced in MariaDB Server 10.2.19 by the backup-safe TRUNCATE TABLE (MDEV-13564, innodb_safe_truncate=ON) and innodb_undo_log_truncate: * MDEV-17780, MDEV-17816, MDEV-17849, MDEV-17851, MDEV-17885 * Several improvements to MariaDB Server and backup for dealing with encrypted or page_compressed pages: * MDEV-12112: corruption in encrypted table may be overlooked * MDEV-17958: On little-endian systems, remove bug-compatible variant of innodb_checksum_algorithm=crc32 * MDEV-17957: Make innodb_checksum_algorithm stricter for strict_* values * MDEV-18025: Mariabackup fails to detect corrupted page_compressed=1 tables * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10221-release-notes https://mariadb.com/kb/en/library/mariadb-10221-changelog https://mariadb.com/kb/en/library/mariadb-10220-release-notes https://mariadb.com/kb/en/library/mariadb-10220-changelog - update suse_skipped_tests.list- remove PerconaFT from the package as it has AGPL licence [bsc#1118754] - use a new syntax for cmake variables that specify which plugin will be built- Add patch to link against libatomic where necessary and use C++11 atomics instead of gcc built-in atomics * mariadb-10.2.19-link-and-enable-c++11-atomics.patch - Add two tests to suse_skipped_tests.list for ppc * encryption.innodb-bad-key-change2 * encryption.innodb-bad-key-change4- update to 10.2.19 GA [bsc#1116686] * notable changes: * innodb_safe_truncate system variable for a backup-safe TRUNCATE TABLE implementation that is based on RENAME, CREATE, DROP (MDEV-14717, MDEV-14585, MDEV-13564). Default value for this variable is ON. If you absolutely must use XtraBackup instead of Mariabackup, you can set it to OFF and restart the server * MDEV-17289: Multi-pass recovery fails to apply some redo log records * MDEV-17073: INSERT…ON DUPLICATE KEY UPDATE became more deadlock-prone * MDEV-17491: micro optimize page_id_t * MDEV-13671: InnoDB should use case-insensitive column name comparisons like the rest of the server * Fixes for indexed virtual columns: MDEV-17215, MDEV-16980 * MDEV-17433: Allow InnoDB start up with empty ib_logfile0 from mariabackup --prepare * MDEV-12547: InnoDB FULLTEXT index has too strict innodb_ft_result_cache_limit max limit * MDEV-17541: KILL QUERY during lock wait in FOREIGN KEY check causes hang * MDEV-17531: Crash in RENAME TABLE with FOREIGN KEY and FULLTEXT INDEX * MDEV-17532: Performance_schema reports wrong directory for the temporary files of ALTER TABLE…ALGORITHM=INPLACE * MDEV-17545: Predicate lock for SPATIAL INDEX should lock non-matching record * MDEV-17546: SPATIAL INDEX should not be allowed for FOREIGN KEY * MDEV-17548: Incorrect access to off-page column for indexed virtual column * MDEV-12023: Assertion failure sym_node->table != NULL on startup * MDEV-17230: encryption_key_id from alter is ignored by encryption threads * fixes for the following security vulnerabilities: CVE-2018-3282 [bsc#1112432], CVE-2016-9843 [bsc#1013882], CVE-2018-3174 [bsc#1112368], CVE-2018-3143 [bsc#1112421], CVE-2018-3156 [bsc#1112417], CVE-2018-3251 [bsc#1112397], CVE-2018-3185 [bsc#1112384], CVE-2018-3277 [bsc#1112391], CVE-2018-3162 [bsc#1112415], CVE-2018-3173 [bsc#1112386], CVE-2018-3200 [bsc#1112404], CVE-2018-3284 [bsc#1112377] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10219-release-notes https://mariadb.com/kb/en/library/mariadb-10219-changelog - do not pack libmariadb.pc (packed in mariadb-connector-c)- add "Requires: libmariadb_plugins" to the mariadb-test subpackage in order to be able to test client plugins successfuly [bsc#1111859] - don't remove debug_key_management.so anymore [bsc#1111858]- update to 10.2.18 GA * notable changes: * MDEV-15511 - if available, stunnel can be used during Galera rsync SST * MDEV-16791 - mariabackup: Support DDL commands during backup * MDEV-13564 - Refuse MLOG_TRUNCATE in mariabackup * MDEV-16934 - add new system variable eq_range_index_dive_limit to speed up queries that new long nested IN lists. The default value, for backward compatibility, is 0 meaning "unlimited". * MDEV-13333 - errors on InnoDB lock conflict * Report all InnoDB redo log corruption * MDEV-17043 - Purge of indexed virtual columns may cause hang on table-rebuilding DDL * MDEV-16868 - corruption of InnoDB temporary tables * MDEV-16465 - Invalid (old?) table or database name or hang in ha_innobase::delete_table and log semaphore wait upon concurrent DDL with foreign keys * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10218-release-notes https://mariadb.com/kb/en/library/mariadb-10218-changelog - refresh mariadb-10.2.4-fortify-and-O.patch- add ssl tests that are failing with OpenSSL 1.1.1 to suse_skipped_tests.list [MDEV-17184]- update to 10.2.17 GA * notable changes: * New variable innodb_log_optimize_ddl for avoiding delay due to page flushing and allowing concurrent backup * InnoDB updated to 5.7.23 * MDEV-14637 - Fix hang due to DDL with FOREIGN KEY or persistent statistics * MDEV-15953 - Alter InnoDB Partitioned Table Moves Files (which were originally not in the datadir) to the datadir * MDEV-16515 - InnoDB: Failing assertion: ++retries < 10000 in file dict0dict.cc line 2737 * MDEV-16809 - Allow full redo logging for ALTER TABLE * Temporary tables: MDEV-16713 - InnoDB hang with repeating log entry * indexed virtual columns: MDEV-15855 - Deadlock between purge thread and DDL statement * MDEV-16664 - Change the default to innodb_lock_schedule_algorithm=fcfs * Galera: MDEV-15822 - WSREP: BF lock wait long for trx * fixes for the following security vulnerabilities: CVE-2018-3064 [bsc#1103342], CVE-2018-3063 [bsc#1101677], CVE-2018-3058 [bsc#1101676], CVE-2018-3066 [bsc#1101678], CVE-2018-3060 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10217-release-notes https://mariadb.com/kb/en/library/mariadb-10217-changelog- switch to libedit as control sequences were already fixed there so we don't have to avoid it [bsc#1098683]- update to 10.2.16 GA * notable changes: * MDEV-13122: mariabackup now supports MyRocks * MDEV-13779 - InnoDB fails to shut down purge workers, causing hang * MDEV-16267 - Wrong INFORMATION_SCHEMA.INNODB_BUFFER_PAGE.\ TABLE_NAME * MDEV-13834 - Upgrade failure from 10.1 innodb_encrypt_log * MDEV-16283 - ALTER TABLE...DISCARD TABLESPACE still takes long on a large buffer pool * MDEV-16376 - ASAN: heap-use-after-free in gcol.innodb_virtual_debug * MDEV-15824 - innodb_defragment=ON trumps innodb_optimize_fulltext_only=ON in OPTIMIZE TABLE * MDEV-16124 - fil_rename_tablespace() times out and crashes server during table-rebuilding ALTER TABLE * MDEV-16416 - Crash on IMPORT TABLESPACE of a ROW_FORMAT=COMPRESSED table * MDEV-16456 - InnoDB error "returned OS error 71" complains about wrong path * MDEV-13103 - Deal with page_compressed page corruption * MDEV-16496 - Mariabackup: Implement --verbose option to instrument InnoDB log apply * MDEV-16087 - Inconsistent SELECT results when query cache is enabled * MDEV-15114 - ASAN heap-use-after-free in mem_heap_dup or dfield_data_is_binary_equal (fix for indexed virtual columns) * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10216-release-notes https://mariadb.com/kb/en/library/mariadb-10216-changelog - refresh mariadb-5.5.28-install_db-quiet.patch - refresh mariadb-10.2.9-galera_cnf.patch - pack wsrep_sst_rsync_wan file to galera subpackage - update suse_skipped_tests.list- Don't require systemd explicit, spec file can handle both cases correct and in containers we don't have systemd.- update to 10.2.15 GA * notable changes: * PCRE updated to 8.42 * The embedded server library now supports SSL when connecting to remote servers [bsc#1088681], [CVE-2018-2767] * MDEV-15325 - Incomplete validation of missing tablespace during recovery * MDEV-15720 - ib_buffer_pool unnecessarily includes the temporary tablespace * MDEV-15764 - InnoDB may write uninitialized garbage to redo log * MDEV-15553 - Virtual Columns: Assertion failed in dict_table_get_col_name * MDEV-14705 - slow innodb startup/shutdown can exceed systemd timeout * MDEV-15507 - Assertion failed in dict_check_sys_tables on upgrade from 5.5 * MDEV-15916 - Change buffer crash during TRUNCATE or DROP TABLE * encryption fixes - MDEV-12632, MDEV-13516, MDEV-15752, MDEV-15566, MDEV-16092 * temporary table ROLLBACK fixes - MDEV-15826, MDEV-15374 * applicable changes from 5.7.22 - MDEV-16142 * fixes for the following security vulnerabilities: CVE-2018-2786, CVE-2018-2759, CVE-2018-2777, CVE-2018-2810, CVE-2018-2782, CVE-2018-2784, CVE-2018-2787, CVE-2018-2766, CVE-2018-2755, CVE-2018-2819, CVE-2018-2817, CVE-2018-2761, CVE-2018-2781, CVE-2018-2771, CVE-2018-2813 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10215-release-notes https://mariadb.com/kb/en/library/mariadb-10215-changelog - update suse_skipped_tests.list and add tests that are failing with GCC 8 [bsc#1092544], MDEV-16127 - do not build TokuDB as a build without jemalloc is not supported upstream- update suse_skipped_tests.list and add failing tests for s390- update to 10.2.14 GA * notable changes: * MyRocks is now Gamma (RC) * MDEV-14533 - Added the DISKS plugin, for monitoring disk space * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY. * MDEV-15333 - MariaDB (still) slow start * MDEV-12255 - Wrong result with innodb_prefix_index_cluster_optimization * MDEV-12396 - IMPORT TABLESPACE cleanup * MDEV-14648 - Restore fix for MySQL BUG#39053 - UNINSTALL PLUGIN does not allow the storage engine to cleanup open connections * MDEV-15249 - IMPORT fixes * MDEV-14988 - innodb_read_only tries to modify files if transactions were recovered in COMMITTED state * MDEV-14773 - DROP TABLE hangs for InnoDB table with FULLTEXT index (fixing a recent regression from upstream) * MDEV-15529 - IMPORT TABLESPACE unnecessarily uses the doublewrite buffer * MDEV-15554 - InnoDB page_cleaner shutdown sometimes hangs * MDEV-14545 - Mariabackup - Backup fails due to MLOG_INDEX_LOAD record * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10214-release-notes https://mariadb.com/kb/en/library/mariadb-10214-changelog - remove the following patches * mariadb-10.2.14-xtrabackup-v2.patch (applied upstream, MDEV-15254) * mariadb-10.2.13-aarch_compilefix.patch (applied upstream, MDEV-14318) * mariadb-10.2.10-disable_openssl_compatibility_check.patch (fixed upstream in https://github.com/MariaDB/server/pull/558) * mariadb-10.2.8-systemd-cmake.patch and DWITH_SYSTEMD=ON compile option that are no longer needed - systemd is detected correctly now (discussed in [bsc#1080891] and MDEV-8379) * mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch (fixed upstream in 52516706c86f9f66c76836eabde7e2477694bac3) * remove mariadb-10.2.3-group.patch that was just a half solution of the group support (missing server part) and moreover using a group option in mysql-systemd-helper was removed few years ago as it caused troubles because MariaDB resolved it as 'group_concat_max_len option' (see https://github.com/openSUSE/mysql-packaging/issues/15) - remove jar files from the tarball (used for testing from the source) - build TokuDB without the jemalloc support for now. Jemalloc 5 is not backwards compatible which leads to the errors in the testsuite at least (MDEV-15034) - update suse_skipped_tests.list- change %{extra_provides} macro from "mariadb_102" to "mariadb-102" and use this macro in Provides/Obsoletes for mariadb, test, tools, bench and errormessages subpackages to ensure a smooth transition from SLE12 to SLE15 [fate#323756] - remove "Provides: mariadb-errormessages = 10.1.25" that shouldn't be needed anymore- fix build on aarch64: compile a few more files with -O0 from https://jira.mariadb.org/browse/MDEV-14318 add patch mariadb-10.2.13-aarch_compilefix.patch- add mariadb-10.2.14-xtrabackup-v2.patch (bsc#1083087)- update to 10.2.13 GA * notable changes * InnoDB updated to 5.7.21 * Galera wsrep library updated to 25.3.23 * MDEV-13869 - MariaDB slow start * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY * MDEV-15249 - Crash in MVCC read after IMPORT TABLESPACE * Foreign key bugs: * MDEV-15199 - Referential integrity broken in ON DELETE CASCADE/MDEV-14222 Unnecessary 'cascade' memory allocation for every updated row * MDEV-15219 - FOREIGN KEY CASCADE or SET NULL operations will not resume after lock wait * MDEV-15042 - INSERT ON DUPLICATE KEY UPDATE produces error 1032 (Can't find record) * MDEV-13205 - InnoDB: Failing assertion: !dict_index_is_online_ddl(index) upon ALTER TABLE * MDEV-14958 - Merge new release of InnoDB MySQL 5.7.21 to 10.2 * MDEV-15165 - InnoDB purge for index on virtual column is trying to access an incomplete record * MDEV-15143 - InnoDB: Rollback of trx with id 0 completed * MDEV-11415 - Remove excessive undo logging during ALTER TABLE…ALGORITHM=COPY * MDEV-15016 - multiple page cleaner threads use a lot of CPU * MDEV-14941 - Timeouts on persistent statistics tables caused by MDEV-14511 * MDEV-14985 - innodb_undo_log_truncate may be blocked if transactions were recovered at startup * MDEV-14441 - InnoDB hangs when setting innodb_adaptive_hash_index=OFF during UPDATE * MDEV-14887 - On a 32-bit system, MariaDB 10.2 mishandles data file sizes exceeding 4GiB * fixes for the following security vulnerabilities: * CVE-2018-2562, CVE-2018-2622, CVE-2018-2640, CVE-2018-2665, CVE-2018-2668, CVE-2018-2612 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10213-release-notes/ https://mariadb.com/kb/en/library/mariadb-10213-changelog/ * fixes [bsc#1058729] and [bsc#1068906] - refresh mariadb-10.2.10-disable_openssl_compatibility_check.patch - refresh mariadb-10.2.3-group.patch- add dependency on which for galera scripts- change owner of mysql-test directory from root to mysql. It also fixes sys_vars.secure_file_priv running under mysql user (e.g. if ít's started via suse-test-run script) that needs to be able to create a test file there during its run [bsc#1012075]- update to 10.2.12 GA * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10212-release-notes/ https://mariadb.com/kb/en/library/mariadb-10212-changelog/ - remove mysql-community-server-5.5.6-safe-process-in-bin.patch becuase this moving is done in the specfile - get rid of the archive with patches (remove mysql-patches.tar.xz and series files), handle patches in the standard way mysql-community-server-5.1.45-multi-configuration.patch mariadb-10.2.4-logrotate.patch mariadb-5.5.28-install_db-quiet.patch mariadb-10.1.1-mysqld_multi-features.patch mariadb-5.2.3-cnf.patch mariadb-10.2.3-group.patch mariadb-10.1.12-deharcode-libdir.patch mariadb-10.0.15-logrotate-su.patch mariadb-10.2.4-fortify-and-O.patch mariadb-10.2.8-systemd-cmake.patch mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch mariadb-10.2.9-galera_cnf.patch mariadb-10.2.10-disable_openssl_compatibility_check.patch - add comments to the section with removing unused files (based on https://lists.launchpad.net/maria-developers/msg11028.html) - put rm statements together - install the new upstream systemd-tmpfiles configuration file 'tmpfiles.conf' and rename it to 'mariadb.conf' in order to follow the manual - remove the new upstream systemd-sysusers configuration file as we handle creating of mysql user in the specfile - mysql.service: remove calling of the wait function and let systemd to do this job. Switch from 'Type=simple' to 'Type=notify' and add TimeoutSec=300 - rename unit files from mysql to mariadb and add mysql alias for the backward compatibility [bsc#1067443] * mysql.service -> mariadb.service * mysql.target -> mariadb.target * mysql@.service -> mariadb@.service - remove configuration-tweaks.tar.xz and move configuration to my.ini/my.cnf file (omit default_plugins.cnf as all configuration here was commented out) - add a numeric prefix for galera.cnf file in order to allow users to speficy in which order the configs will be loaded within the my.cnf.d directory [bsc#1055268] - add 'bind-address = 127.0.0.1' as a default option to my.cnf file for security reasons (disable MariaDB to listen for TCP/IP connections by default) [bsc#1058374] - update my.cnf file and add a section with SSL configuration [bsc#1058374]- switch from deprecated 'net-tools' to 'iproute2' for mariadb-galera subpackage. This dependency switch is sufficient for making wsrep_sst_rsync.sh script to use 'ip' instead of 'ifconfig' command- Do not manually delete %{_localstatedir}/adm/update-messages/%{name}-%{version}-%{release}-something: The file is listed as ghost and thus properly owned by the package. - Use %tmpfiles_create which can cope with transactional updates.- update to 10.2.11 GA * release notes and changelog: * https://mariadb.com/kb/en/library/mariadb-10211-release-notes/ * https://mariadb.com/kb/en/library/mariadb-10211-changelog/ - pack additional mroonga/groonga files - change default charset to utf8mb4 for full Unicode support [fate#324329] - remove mariadb-10.2.10-wsrep_sst_common.patch as it's no longer needed- Added mariadb-10.2.10-wsrep_sst_common.patch (bsc#1069401). Upstream bug: https://jira.mariadb.org/browse/MDEV-14256- Disable openssl compatibility checking * the check uses CRYPTO_set_mem_functions() to set debugging memory allocation function. The setting only succeeds if no allocation was done before. Our fips self-tests, which are run from the library constructor, however, do allocate memory, so the subsequent call to CRYPTO_set_mem_functions causes the compatibility check to fail * add mariadb-10.2.10-disable_openssl_compatibility_check.patch- update to 10.2.10 GA * release notes and changelogs https://downloads.mariadb.org/mariadb/+releases/ * fixes for the following security vulnerabilities * 10.2.10: CVE-2017-10378, CVE-2017-10268, CVE-2017-15365 * 10.2.8: CVE-2017-3636, CVE-2017-3641, CVE-2017-3653, CVE-2017-10320, CVE-2017-10365, CVE-2017-10379, CVE-2017-10384, CVE-2017-10286, CVE-2017-3257 * 10.2.6: CVE-2017-3308, CVE-2017-3309, CVE-2017-3453, CVE-2017-3456, CVE-2017-3464 * 10.2.5: CVE-2017-3313, CVE-2017-3302 * [bsc#1042632], [bsc#1043328], [bsc#1019948], [fate#323738] - refresh and rename the following patches: * mariadb-10.1.4-group.patch to mariadb-10.2.3-group.patch * mariadb-10.1.16-systemd-cmake.patch to mariadb-10.2.8-systemd-cmake.patch * mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch * mariadb-10.1.12-fortify-and-O.patch to mariadb-10.2.4-fortify-and-O.patch * mysql-community-server-5.1.46-logrotate.patch to mariadb-10.2.4-logrotate.patch - add mariadb-10.2.10.tar.gz.sig signature and mariadb.keyring files - start building without client library part, use mariadb-connector-c for getting libmariadb libraries. Remove libmysclient* packages - remove baselibs.conf because we no longer build client libraries here - update %{soname} to 19 (libmysqld soname) - change '=' to '>=' in Requires:mariadb-errormessages for libmysqld%{soname}. Versioned libraries shouldn't require regular packages with '='. It also causes problems during update (Problem: libmysqld18-10.1.25-3.1.x86_64 requires mariadb-errormessages = 10.1.25, but this requirement cannot be provided). Also add "Provides: mariadb-errormessages = 10.1.25" for errormessages subpackage that solves this problem for the current update. - pack new files, remove mysql specific files - remove README.SUSE as it was outdated - package cleaning * run spec-cleaner * renumber sources * reorganize subpackages order and update summaries, descriptions and groups * tweak and add some comments to the specfile * remove warning about mysql-packaging repository that is no longer used for this package * remove checks whether we build mysql or mariadb (we build mariadb only) - add galera subpackage * add missing "Requires:" (lsof, net-tools, rsync, socat, xtrabackup) for proper wsrep scripts functionality * add mariadb-10.2.9-galera_cnf.patch that enhances galera.cnf configuration file (add wsrep_on=OFF and set the location of the wsrep library) * rename README-wsrep to README.wsrep so it corresponds with the other README names * move galera_new_cluster, galera_recovery, use_galera_new_cluster.conf, wsrep_* scripts to the galera subpackage - remove the following macros definitions: * %{_tmpfilesdir} - it's been defined in systemd macros since openSUSE 13.2 * %{preferred} - we no longer need to distinguish between preferred and not preferred version (we build mariadb only) * %{with_mandatory_lz4} - mysql specific * %{build_extras}, %{pretty_name}, %{build_readline}, %{builtin_plugins} and {libname} - they are no longer needed - add the following macros * %{run_testsuite} macro that controls the run of the regression testsuite * %{ignore_testsuite_result} macro - when set to 1 it ignores results from the regression testsuite (debug purposes) * %{with_mroonga} macro (enable mroonga build for x86_64 archs only) - rename %{with_jemalloc} to %{with_tokudb} and enable tokudb for x86_64 architectures for openSUSE and SLE15 [fate#323280]. Don't enable it for SLE12 (missing jemalloc dependency) - add the following BuildRequires: * unixODBC-devel to allow ODBC support for Connect engine [bsc#1039034] * krb5-devel to build auth_gssapi.so plugin * libarchive-devel * use libboost_headers-devel instead of boost-devel for TW. Boost package has been split up and will migrate to using multibuild. This results in packages that unnecessarily build require boost-devel to cause major bottlenecks [bsc#1062583] - do not use "BuildRequires: lzo-devel" for i586 and arm because it makes build fail - add the following Requires: * hostname - as mariadb_install_db depends on this tool [bsc#1060110] * libaio-devel for libmysqld-devel because libmysqld depends on libaio - tweak build options: * remove "DWITH_ASAN=OFF" - this option was added because of mysql and it's no longer needed * switch from "-DWITH_JEMALLOC=auto" to "-DWITH_JEMALLOC=system" * use "DCMAKE_SKIP_INSTALL_RPATH" - this allows to link with -rpath during build and fixes quite a few test suite failures. When installing the file -rpath is still disabled, so this should not have any effect on the installed binaries * add "-DWITH_LIBARCHIVE=ON" and "-DWITH_MARIABACKUP=ON" * remove -DWITH_BOOST=../boost/ as we use system boost now - enable OQGRAPH to build (openSUSE only, SLE is missing Judy requirement) - disable Cassandra storage engine build as it's no longer actively being developed (See MDEV-4695) [bsc#1055165] * Remove "BuildRequires: libthrift-devel" and %{with_cassandra} macros that are no longer needed now - disable make test (Connector/C unit tests) as it requires a running server. These tests are part of mysql-test-run now (MDEV-12470) - add suse_skipped_tests.list - the list of the tests that we want to skip (they fail correctly or the fix is in progress) * adjust mysql-test-run options to skip tests listed there [bsc#1041891] - remove mytop utility that is packaged separately - remove *.jar files from mysql-test - remove python scripts remains from tokudb upstream - remove generating of the MySQL NDB Cluster filelists - remove removing of manpages for MySQL Carrier Grade Edition - provide a symlink for the my_safe_process executable that was moved from its location to bindir - update filename in /var/adm/update-messages to match documentation and build-compare pattern - README is now README.md - fix "file listed twice" build error- Also Require: libopenssl-1_0_0-devel from the libmysqlclient-devel package- Drop INFO_BIN from package because it is not needed and differs for every build (boo#1047218)- Explicitly require libopenssl-1_0_0-devel, to successfully build once we switch openssl to 1.1 (bsc#1042632)- update to MariaDB 10.1.25 GA * notable changes * MariaDB can no longer be compiled with OpenSSL version 0.9.8 and below. The last 0.9.8 release was in December 2015, it is out of support and is no longer getting security fixes. * MariaDB Backup is now beta * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10125-release-notes * https://mariadb.com/kb/en/mariadb/mariadb-10125-changelog * refresh mariadb-10.1.12-fortify-and-O.patch * remove mariadb-10.1.22-xtradb_null_checks.patch (MDEV-12358), a fix was merged upstream * update file lists for new man-pages and tools - switch from 'Restart=on-failure' to 'Restart=on-abort' in mysql.service in order to follow the upstream- Add mariadb-10.1.22-xtradb_null_checks.patch (boo#1041525) (See also https://jira.mariadb.org/browse/MDEV-12358) - switch from '/var/run' to '/run' as /var/run is just a symlink to /run - fix permissions for /var/run/mysql that were wrongly set to 700 instead of 755 due to added umask. This prevented non-root from connecting to the database [bsc#1038740] - change permissions of the configuration dir/files to 755/644. Please note that storing the password in the /etc/my.cnf file is not safe. Use for example an option file that is accessible only by yourself [bsc#889126] - set the default umask to 077 in mysql-systemd-helper [bsc#1020976]- increase required physical memory in _constraints from 5 GB to 7 GB in order to try to fix i586 build that fails because of "Out of memory" error- update to MariaDB 10.1.22 GA * notable changes * XtraDB updated to 5.6.35-80.0 * TokuDB updated to 5.6.35-80.0 * PCRE updated to 8.40 * MDEV-12160: ed25519 authentication plugin * MDEV-11842: Fix a 10.1.21 regression with failed INSERT, BEFORE INSERT triggers, and columns with no default value * MDEV-12075: Fix a 10.1.21 regression in the InnoDB data file extension code * MDEV-11027: better InnoDB crash recovery progress reporting * MDEV-11520: improvements to how InnoDB data files are extended * Improvements to InnoDB startup/shutdown to make it more robust * MDEV-11233: fix for FULLTEXT index crash * MDEV-9734: systemd compatible bintar files now available * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10122-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10122-changelog/ * fixes the following CVEs: * CVE-2017-3313 [bsc#1020890], CVE-2017-3302 [bsc#1022428] - refresh mysql-community-server-5.1.46-logrotate.patch - refresh mariadb-10.1.16-systemd-cmake.patch - remove mariadb-10.1.20-incorrect_list_handling.patch that is no longer needed [bsc#1022428] [CVE-2017-3302]- update to MariaDB 10.1.21 * notable changes: * Innodb updated to 5.6.35 * Performance Schema updated to 5.6.35 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10121-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10121-changelog/ * fixes the following CVEs: CVE-2017-3318 [bsc#1020896], CVE-2017-3317 [bsc#1020894], CVE-2017-3312 [bsc#1020873], CVE-2017-3291 [bsc#1020884], CVE-2017-3265 [bsc#1020885], CVE-2017-3258 [bsc#1020875], CVE-2017-3257 [bsc#1020878], CVE-2017-3244 [bsc#1020877], CVE-2017-3243 [bsc#1020891], CVE-2017-3238 [bsc#1020882], CVE-2016-6664 [bsc#1008253] - add mariadb.te file to the filelist - add mysqld_safe_helper to the filelist - refresh mariadb-10.1.4-group.patch - add mariadb-10.1.20-incorrect_list_handling.patch to fix incorrect linked list handling in mysql_prune_stmt_list() function that can cause use-after-free error [bsc#1022428]- Replace systemd and systemd-devel BuildRequires with pkgconfig(libsystemd), which matches what the build system is actually looking for.- update to MariaDB 10.1.20 * notable changes: * XtraDB updated to 5.6.34-79.1 * TokuDB updated to 5.6.34-79.1 * HeidiSQL updated to 9.4 * The limit for the table_open_cache system variable has been increased to 1024K * Galera wsrep library updated to 25.3.19 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10120-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10120-changelog/- update to MariaDB 10.1.19 * notable changes: * XtraDB updated to 5.6.33-79.0 * TokuDB updated to 5.6.33-79.0 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10119-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10119-changelog/ * fixes for the following security vulnerabilities: CVE-2016-7440 [bsc#1005581] CVE-2016-5584 [bsc#1005558] - add mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to fix mysql_install_db.sh script to find data files in mariadb directories when a user uses "--basedir" option [bsc#1006539] - switch to xz compression instead of bz2 for the following tarballs: * mysql-patches.tar.bz2 renamed to mysql-patches.tar.xz * configuration-tweaks.tar.bz2 renamed to configuration-tweaks.tar.xz replace occurrences of "bzip2" with "xz" in README.debug- update to 10.1.18 * Release notes: https://mariadb.com/kb/en/mariadb/mariadb-10118-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10117-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10116-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10115-release-notes/ * Changelog: https://mariadb.com/kb/en/mariadb/mariadb-10118-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10117-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10116-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10115-changelog/ * fixed CVE's: CVE-2016-8283, CVE-2016-6663, CVE-2016-5629, CVE-2016-5626, CVE-2016-5624, CVE-2016-5616, CVE-2016-3492, CVE-2016-6662, CVE-2016-5440, CVE-2016-3615, CVE-2016-3521, CVE-2016-3477 * fix: [bsc#1005582], [bsc#1001367], [bsc#1005569], [bsc#1005566], [bsc#1005564], [bsc#1005562], [bsc#1005555], [bnc#998309], [bsc#989926], [bsc#989922], [bsc#989919], [bsc#989913] * refresh mariadb-10.1.4-group.patch * refresh mariadb-10.1.12-fortify-and-O.patch - requires devel packages for aio and lzo2 - remove mariadb-10.0.21-mysql-test_main_bootstrap.patch that is no longer needed [bnc#984858] - append "--ignore-db-dir=lost+found" to the mysqld options in "mysql-systemd-helper" script if "lost+found" directory is found in $datadir [bnc#986251] - remove syslog.target from *.service files [bsc#983938] - add BuildRequires: systemd-devel - make some dependecies switchable - add systemd to deps to build on leap and friends - add mariadb-10.1.16-systemd-cmake.patch to allow more (case-insensitive) values for 'WITH_SYSTEMD' variable in systemd.cmake - replace '%{_libexecdir}/systemd/system' with %{_unitdir} macro - remove useless mysql@default.service [bsc#971456] - replace all occurrences of the string "@sysconfdir@" with "/etc" in mysql-community-server-5.1.46-logrotate.patch as it wasn't expanded properly [bsc#990890]- update to 10.1.14 * What is MariadDB 10.1: https://mariadb.com/kb/en/mariadb/what-is-mariadb-101/ * CVEs fixed in 10.1.x branch CVE-2016-2047, CVE-2016-0668, CVE-2016-0651, CVE-2016-0650, CVE-2016-0649, CVE-2016-0646, CVE-2016-0644, CVE-2016-0642, CVE-2016-0641, CVE-2016-0640, CVE-2016-0616, CVE-2016-0610, CVE-2016-0609, CVE-2016-0608, CVE-2016-0606, CVE-2016-0600, CVE-2016-0598, CVE-2016-0597, CVE-2016-0596, CVE-2016-0546, CVE-2016-0505, CVE-2015-7744, CVE-2015-4913, CVE-2015-4895, CVE-2015-4879, CVE-2015-4870, CVE-2015-4866, CVE-2015-4864, CVE-2015-4861, CVE-2015-4858, CVE-2015-4836, CVE-2015-4830, CVE-2015-4826, CVE-2015-4819, CVE-2015-4816, CVE-2015-4815, CVE-2015-4807, CVE-2015-4802, CVE-2015-4792 * adjust mysql-patches.tar.bz2 archive for mariadb-101 * pack new MariaDB 10.1.x files - remove '%define _rundir' as 13.1 is out of support scope - temporarily disable OQGraph It seems to need the boost library with the version not earlier than 1.40 and not later than 1.55 (MDEV-9479) - add "BuildRequires: systemd-devel" for SLE12, openSUSE 13.2 and openSUSE Leap in order to enable systemd features during the build of mariadb-101 for these products. Otherwise we get "Performing Test HAVE_SYSTEMD - Failed" and systemd files aren't installed. - re-enable profiling support - don't remove HandlerSocket plugin [bnc#979524] - add 'log-error' and 'secure-file-priv' configuration options (added via configuration-tweaks.tar.bz2) [bsc#963810] * add '/etc/my.cnf.d/error_log.conf' that specifies 'log-error = /var/log/mysql/mysqld.log'. If no path is set, the error log is written to '/var/lib/mysql/$HOSTNAME.err', which is not picked up by logrotate. * add '/etc/my.cnf.d/secure_file_priv.conf' which specifies that 'LOAD DATA', 'SELECT ... INTO' and 'LOAD FILE()' will only work with files in the directory specified by 'secure-file-priv' option (='/var/lib/mysql-files'). - run 'usermod -g mysql mysql' only if mysql user is not in mysql group. Run 'usermod -s /bin/false/ mysql' only if mysql user doesn't have '/bin/false' shell set. - don't delete the log data when migration fails- fix constraints conditions for 32bit architectures- fix information leak via mysql-systemd-helper script [CVE-2015-5969], [bnc#957174]- update to 10.0.22 * Release notes: https://kb.askmonty.org/en/mariadb-10022-release-notes/ * Changelog: https://kb.askmonty.org/en/mariadb-10022-changelog/ * fixed CVEs: CVE-2015-4802, CVE-2015-4807, CVE-2015-4815, CVE-2015-4826 CVE-2015-4830, CVE-2015-4836, CVE-2015-4858, CVE-2015-4861 CVE-2015-4870, CVE-2015-4913, CVE-2015-4792 * remove the following patches (applied upstream) * mysql-community-server-5.6.12-srv_buf_size.patch * mariadb-10.0.16-header_files_const_warnings.patch - add mariadb-10.0.21-mysql-test_main_bootstrap.patch that fix main.bootstrap test (change default charset to utf8 in test result) [bnc#937787] - add mariadb-10.0.22-fix_build_denabled_profiling_off.patch to fix compilation with '-DENABLED_PROFILING=OFF'- update to MariaDB 10.0.21 * changes: * https://mariadb.com/kb/en/mariadb/mariadb-10021-release-notes * the following patches were processed upstream and are no longer needed: * mariadb-5.5.28-hotcopy.patch * mariadb-5.1.50-strncat-overflow.patch * mysql-community-server-5.1.51-mysql_config.patch * mariadb-5.5.32-upgrade-exit-status.patch * mariadb-5.5.41-mariadb-admincrash.patch - use syntax in mysql-systemd-helper that is accepted by both mariadb and mysql [bnc#937767] - fix spurious macro expansion in comment in specfile - install INFO_BIN and INFO_SRC, noticed in MDEV-6912 - replace readline-devel for readline5-devel (MDEV-6912) [bnc#902396] - use spec-cleaner - Tweak some cmake switches to enable more things * WITH_ASAN=OFF adress sanitization WITH_LIBWRAP=ON tcp wrappers ENABLED_PROFILING=OFF profiling disable (for mysql) ENABLE_DEBUG_SYNC=OFF debug testing sync disable (for mysql) WITH_PIC=ON by default we want pic generated binaries (for mysql) - set cmake options for MariaDB Galera Cluster - remove superfluous '--group' parameter from mysql-systemd-helper - make -devel package installable in the presence of LibreSSL - cleanup after the update-message if it was displayed - add 'exec' to mysql-systemd-helper to shutdown mysql/mariadb cleanly [bnc#943096] - remove redundant entry from %{_tmpfilesdir}/mysql.conf. Using both 'x' and 'X' options is redundant and causes a warning message. Leaving only the 'x' line fixes this problem. [bnc#942908]- Sync to git state, fixes bnc#937754 too- Sync to git state fixing few triv issues- Enable testsuite- Update to 10.0.20: https://mariadb.com/kb/en/mariadb/mariadb-10020-release-notes/ * Fixes bnc#934789 Logjam Attack using 512bit dh groups in ssl - Sync the package to git state, redoing initscripts to be more robust- Update to 10.0.19, sync to git state of repository: https://mariadb.com/kb/en/mariadb/mariadb-10019-release-notes/- fix parent directory has insecure permissions error- disable optional features for mariadb * still possible to use them from mariadb_100 package- Adjust _constraints. 11GB is not enough for ppc64 builds, increase to 13GB- fix build for openSUSE 13.2 ppc bnc#921955- Updated to the version 10.0.17 * Release notes: http://kb.askmonty.org/v/mariadb-10017-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10017-changelog - merged patches to packaging git and regenerated * few fixes mainly to upgrades- README.SuSE is now README.SUSE; fix name in some places.- Fix undefined initial status in systemd script (boo #914370)- Fix include dir in alternative cnf files (bnc #859345)- run spec cleaner on spec - update to 10.0.15 * Release notes: http://kb.askmonty.org/v/mariadb-10015-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10015-changelog - conditionally enable more storage engines - updated packaging to the latest templates- fix bashism in posttrans script/bin/shmysql-clienth01-ch4c 1725036770  !10.11.9-150600.4.6.110.11.9-150600.4.6.110.11.9-150600.4.6.110.11.910.11.9mysqlaccess.confmariadbmariadb-adminmariadb-checkmariadb-dumpmariadb-importmariadb-showmariadbd-safe-helpermysqlmysqladminmysqlcheckmysqld_safe_helpermysqldumpmysqlimportmysqlshowmysql-user.confmysqlplugindialog_examples.somariadb-admin.1.gzmariadb-check.1.gzmariadb-dump.1.gzmariadb-import.1.gzmariadb-show.1.gzmariadb.1.gzmariadbd-safe-helper.1.gzmysql.1.gzmysqladmin.1.gzmysqlcheck.1.gzmysqld_safe_helper.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlshow.1.gz/etc//usr/bin//usr/lib/sysusers.d//usr/lib64//usr/lib64/mysql//usr/lib64/mysql/plugin//usr/share/man/man1/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:35430/SUSE_SLE-15-SP6_Update/6184e569227c549a034fa764fd3e0171-mariadb.SUSE_SLE-15-SP6_Updatedrpmxz5x86_64-suse-linux ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=669a7df9c8ef2616f007e16cccd79d11a904cb33, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=a29be2f3db7e842490410164cf8684cd1c501ee2, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=7827fbb935e96186193474d43a2219ae7eede238, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=22ad14921ddfd7fee2855c76775d47b6c81b0b44, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=582cd259dcdfb183019d10f704debd1dad932c49, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=4a04347eeba0b6480fbcdd57a801edac04ac71d5, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=7da6dfbbd824855686ab3bbec1a44e56c81e65e7, for GNU/Linux 3.2.0, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fa851c23035e378fa75f0af1db71df8545da64c0, strippedtroff or preprocessor input, ASCII text, with no line terminators (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix),=N_pz| RRRRRRRR RRR R R RRRR RRRRRRRRRRRRRR R R RRRR RRR RRRRRRRR R R RRRR RRR RRRRRRRR R RRR RR RRR RRRRRRRR R R RRRR RRR RRRRRRRR R R RRRR RRR RRRRRR R RRR R R RRPPRR Rr`N_z w9utf-8425d4cf243e4c9136cc1fc50f39fdd60d7d4bb0c1d62634ff41bf43682b876ff?7zXZ !t/]"k%-ASDui0o%@I;tpoF \\m~V>t;-eo˄gmbiEc?+-m5{l L;337 8g%P5Z Ӝ4x[Zѫ57@YlD`U* t|oȵqrۚ_d62t&[G+T\?ܔ| 2ʿr#+@}2LU_J|QCŸO^kh K]]N;+nW(=r+QBOcɤy͐KӚSP‹X~x I)@4iW'/csAhU=٠mhyT)waRW0v3r4^Bs/_]$-A:@iy 1v@!4*nCYw*rёL _1wt52QR++ Y ]WNq(ʲWA*emGQ*x뢢 64 ,$2t"I k`; .>;s%n7Z|{RTtG`c. 䫅|RAC1cwwoNm?4ņD#vȸWQ!%X[c,z+'8~M#ljVU5Asz"l~ o-jnPҡl[2WSUIGqA2)5*=^d>Lt ܀7C?km{?yl<9@`/_EAY.d)P~3?Mz<%M*x@#k}CJ/2ef2ACdSŮϹv_+ $I*vUOՕl|E1ͦDcs>w"[/'ytaCjԃ΃w]*ulZcVa'=%z!?4C7C~띥b`M3K &  H/\^Ak$S@&8D \O20iyoɑCcK$3mQ[(ͬGnZU~5ɈÅui O ҬfZʜ> '9pyUy0_:Kd€Ri?i]F2܅j1ABZ ?Gށ:a{_p[XM8doP kymJĕ|ɵYePE|';rs*YL'uh/Αs֔FR57GRJg&L$&,ծiXBS#NUSA"/p7c5@I~ըdU8ѻ}'lΆ<>\7V]7xg!:Jy~S `PM,o9יaA[5r"0fFI3mP{U1S=1K6SIEd|ZkˎR<8P l5?+ӭ_%,bI{K^we}J/Q(wδe݇h04L/Z{LXސ̪u 6(覟3XkrfyO Pߣ$aPOs!!6Hn)~)Bm@T;^C0xq , |puk! E6 TACRGo :-Zv9ʷCpCM$חn75w"j QV.T5zcdx։NǾ{`҇Wh6GP$dz+ʳ<*Mw/UB9iI?łv@]nH jpA.%]4e̻23v$3æn#El{gťBnTi<2zscˁx;:op%% TՆxuc n6{T7af"?'(/@pNU 5X]B޾ ߦlA t((M:7qI pMYYYۈ#'fXVB 3Ú7z4ׅ 9`H4iy7fřͦIs>DArvאx 2aPN{Ru4R_ U5/t %ųOVʔ=ՆB~<2n[VIT6sf7D;`스X.B/LKXvy_: gA,KTkpp^\ꖵ.XVox&P N_dQ0R$ϓ~iU*V%UݖKBG(g@/81g-ջlp=m {ryuL9 5njM ,qb$['{k  `/ ^|DR 56jϨDP$ 섿N QVl.+Yg"H:ϊ܏.9؝:;r[s2fCŰ5Ծl+~QOV}8>ٺx<3Q?ԕwνQk48fS#zJN.K"ʇNQ:gxt_'7$b'wдhDAL)E9c.bo~zB3qn3!$;3 Ra8|;T8~Z3dj+aM(L7ݕ=gkR m/IGFM|]S~p(] *FR?m~UXjviV~3ilȳwoQUֱJ ȸ1g $Pnx9Iny(R1+6q4uz"p!yп\6'a:8[ ]}E䫬NRFWbc@TRAOBnn%ӈWQdi KtAf\u| f o^W=LW4q6|EtC*"lq*2 (عTQL.vwdV=iLNq[}lJ%|;'BZ;`0BU+i_xy* )j >z'Z'ܫx;pCȧktGu)d\ u/압yV"k~MikR)- |.)mГw8dLkL0l6mnI~8HZ",Wh4aPbӿ%&c=ߘnkGp.2T<}aoI2sZ;E)k^;wU4|v%'2{Q/6s'ط⁝q|u*ǁ!Ħ]h}.X Y@FNB1l0b<JG>Bj T6B^H.;>t(-㪓%[dpMsx otG08KG +FDDx-t_a }T(X R⺽K1x]zN9PU/^hrn2 CGzUݭ,C&̸IZOLS#._&Ej7bFt)"u%݁\ QQJfNyp'#mzo*ox.L[`) cfpSwEn T=5M"B4G%RډһQuܹqWpWu>Z6aZ/ 86Bh]:h~%̾g_8FDCtʀw\VRzFf _O\Ǩ|)(𥳐]2J>IYfD{3'E>2E:FBuX Б.3Os 9EtCaFdT3ڙ/I7=fetI^ pOҡT t۞lɏ\96-:$}1 $pM©&><جsEX];5zc q\7QHK~Q"[V 8?@j]XI$}$w s8mtW` )ﺕ\$,z i~b.QSytg&[zx=V"EU/0I_-s}4)(Sf Ut߈]}iZCQ0./ϰ.DV*2uja޷;v|SAM.U*CĉYkJ@˂O')oNXz5 bw yL5=UrW5hIs#(<>>vTrE+<!P7קR QZ#$ G*c)C)t0i)ꓛN\VnD҂"`\0=ur86){ޮ <x-# H $Š&vP&7]TVkuE?RMUĩc]p (w5),~rUP .P}v:5,mPSjrϟ;l$Z0Q>?5mjOIldDYy:ycwKKf u$YMO 0glg:H$1Xžhf nSE[ErVmmp鵊\f ؝TciFјb\E1 y4`QH{IS򌢼]65 Mut$ML`"LRb;!~q >:Lm rHίCt;z=f8!A-E+|t]{]/ܓ31XQrsiR-+أhd24&V`ӄ?HV8i_}0dphprօ+j!7۟e2ɥW^B%^]c͸~roے|Rj~--Z&9Nؿ`TKQ=/2\Px`e}$=Raaݍ.#[8t˻qK#~gSrX,9 ,=<VȌyѓ !)P&r#XB^(g0eVo:B Z^`U}q|ȉ7n0G)%-=tx `uӻ5t,4B5 o6^Dn kJze~kT fB-UGۅpnp W6ı(ldCƙ4~?@AielZh"BpAZ*u|463JV @[](䣣a___{hӷ:##ySIyo;] ʓE|[sLI0@3_m['ܸì W/k;'R`;׋?z1 #Ī́Ɯϰ毬|mM.OCTs5\a;Vt\{YxHIDW2܁snLK" Lw'6*:HgEg8)#ꞳCTq2y@E?V4pNT9 TJSK*Q +>4wAc1yb/ǧt?DCWjbq/)cyG\~Ȑ &lZw|x.$2DQ?OrP9Ph%& 2r{%DU|{!H!oSytU4;)righdP%\~<FQX .Mk8 A~͡**2.c&Łp ";{mr]Y3aeQKkSЋY*sՂ d}PR,5|YiUFx{^ lMo9K!ZɎՂnMI׳V !S.G2hB_F:a#&W?wH+$'MS:Jp'wμb@6M'@{0cXTd/ ̔6YCWz!-Ⱥz>ފ2(l%+q]l5xsQ^6NLFQ< v [!v6{Z+&Uܠؾ}oܚ hy $PQJ/kh{^ݥ#Wm#6E4i2qm7*04-&M #5^~Dtӯ #UwU6oiC>&fIt@%Xb]i:/B}[g~2BE^."c_gÒMD}Ղӊ Բ#Yɽ޷:>4A;h&($ +iW}pWܝ{]}xroQE$fF>ŨVJ<g^-Z|M8J$N5{egtٱS _z@bY*q,;*$K4Gr+V$G~!va!$giӸmC`Გg"C좭D߇_BO^ȃ L>J#\h gө`%5 ~]D.2riOҁ t2v@6>Bbfe@ײ@y@9hL|xUX}u$)J D!ndGIȾ|80 qgoŌTTbwZ<?H%2NkX=T}c"|;J39~fFw#QI 7fw%CvNJ9F+ i@ {%%N@ 1%*l>v@eua=&ÆV0aĈ ef5e Ѿ/*ܞ~Ta4XVF́m\ܠu,m_ZV F'eJ[  Ă35.XEfGJ&+:hyasUbʅAзH5ˑ@5Ia gcleq %wmEu䬵9٥rӴ4,؆ڇ$ Y0KTkMINm`zE[t% {3rAƳvG~e \4q|ʌ~'>[(]j~J٩EzfV?{pA]tsaO^Jq |{d4ޠq{ـL4Cۺ] Z?js9q[pYk J;>Rzd`S7S  %XB24bFA UoCX|ͳC wAlC}ȴ*x&y,ZtB*^^! `_m?15 3 m,rU502KIMRA_b,0InQw5xNU`e}h:P9ړ"$ØY5DMGfvW*]7w{ҬOY]`[ȋdߙ_(%z`K`t732Ieq/ Sm wYO@a!$gcNzc)ĥkVE0jzeflK[$NbxFĶ[J'y&fAIm>z>9DK3ˇ'cOS:r!%Hn-_xm>sg7xjeEB絀%ByH;OHEx=ˎ3d)[&w_YWw{R݌dŸbpώ0⭜SbXLsk8~K+. J Gbۈ^ s.m:KVj,1qȹ`&7_ | ?_&TN%ЫJBc^N+PӲ%ҶlFM˺^Zᗹ(gip/>ckӱ kVH8KeZGi[%TQu_20(ZLJ{FD "!eK*{j!z& z-|ķM~&;Xn(O[U+i~ dE@.E7}+"Xp ۴Jc̤6w` 2I6ˈ:Zw?F;/\-VZg%VuU!p95k4LgHx@l@7aN|њ`e\Unxd.8΀M#O\fc'=ZI@^QK ]2aW6@6HvbO?Ø~#D'u,%_b0[ޱUE$v} E 7[-ɍ5߁\Ô3Ŧ@Uݥ(J7*)#=[N9S'RSD>(S BN=i5Ya01c}5 u3˞wnGaoZ}&rvJz | yC4~ȼ-Xt̙jL^y Z鍲® fz`u)#s}ƞ_Ɇ%7 Q%dУvS#-bdRe,tTN%:%kR‘'E;0; A9WуxRt*mtlךn,X<<q=$€^`02 {Pik~8=p3:1D@qzw]E6p qgҌλ:c`TޱvYv=ҠC s ;:tt)[sI% X91{To;+`|hGqȢ4p,Y{MÍ9ٻ"vA 6 u3X.;=r_cY>ʾqku/gs9pHSG^߂KfZqҜz^&3wUm!j[Q!dۂϘi> #+I=BP۴-p!E-D,虯 enX38ˮA vjY=Q޾LV3SrѲr$C`af6m ir%D`H䢢j<~\+8Md!53_Tcl37R7Z_gQF䗆jk s\K㱿魠ͥ?oQ C 6 vWvP<Јiѽ4 3Tg]`&}o`d&iL74lt96;HNjrt֌$lG]=h`룽I*z$*@DzN+rmNW'm0tl(5,g]0r^5Ag-cT+h]UEGc.}3o891ݍcutHBfk%㹤TT2"酌F7>~$R3K&bπkg B͌/f^G=@̌0SԚ9i'M]Fn7Z5 U*S0+6e c3 P/93DX]k u* CS=w GgTu4Uϯw :1F60߳3%B3 |y.1O0쾞R񜈱u.pTWg1{wm}-dnq1(5 PQɥ + nUdMRgns],im62hN>{PQH 4>'?SESPsnAr8*!1+$WͤoAF:yk5U^ 0oܶ^-إH QN_qe욨V ːBTd ~)g_H<Ʃp,;}lcis%*ACƋꁌ1Oew `Zb+Aq%P^Z7,Wf6|܉.ܔHRadGpxZRѦbQ/ Ns ?<א^W>{o&zE5 ,Teƾ׹N7K+FO|pd{>#wtKw#@C?IH/ EhefG?җ*d?A^2ewbJ>y8@>}o'ǡ yB@#F"d)!#pCfm1z!RQb4߽p<\:0ť:-Y+uQa󳐕%PW>bXSNQ^%gCCywsiU/:@$J ]3&%;GLo6 m7Ck)KW9eU7 jڮot!X$HNo܍QW>*8V!nb$(+xwm P[PTͶNXfܱ;ԁ'3tzuGq\yѲ= hb\BwOk `')E;||;/!dSkg=B Av45/N+m[vKd hV\U TZRjgǵdvf=y/6,qʻV ȺTm5yA= m( ޯSPY "^zMV!e¼?>\\]K70.̓^f"Qrz D< SQ~&i0PS^a#/3duG"2'᥮9 <2)X6"2By=c6O#+c/U74L+(dFWܕyw?ƢDqTk وؒ`<%b*,()6ejZ<Fq?t~ (ͫ9}j ^S@m_vX'o'p M ؿ#IB)0 ,KeDIPH[dJ[dT<Ŋח9uP$-?TJrTyG/v a#9IV"|$7&|27 l"p ZtM|2̃4T^^ v,9}ѩ9Pvdk,' {V2b4Ȉ+‹V5U;ɤWXX$k6~^(dVl KANG<#}˽1]}vpL9_kW_N5B$ q;<$#Bҡ{&0ƶAC.W.[uT0G؞xVpS.O]𴎑pBӱl*J:IE/ g*L /mo}ۂy!;7TiO;~"BR3 rMB%u{ۿeRqFkj{7^.wع`G' 9 DNdӉSCόۋZvʅF[Y:oEbToM]#Uqpr!?/9 Q&>(XzT:aCjx\C$0Տ=6#lfpIOP輶Cɔ:a2Ě2US/msk|5A05$v.9+<Ot=N:s ٿI@-$Vpߧ|FX=NzJۡj:mv..|m7(~ /NV' uB (0x=1~$bIħZ̨ Jrqb=u~렄k` [A#m-b MFcȹk2Hc.[)8܈_8=$?•2?'-n}ԚVmbp.k@TU>>!}UWi4/m4Tr 9B#ˊO(_S4&C)q7#ش߀52sq|jMX *}ұ%b}sRFm4U5nOdZA8ŤӾ'rҾ'5vZ9^u\]m6Clu㊦Rܱâ86q$ͮ#I,cY98lv(7Bm o0,#1)n@P32.PJgbl&|~mD} ksV,L5u+(yvH+ ̫61OO)Btq_㭋> To":p+0lHl[f:- FәyR?5/,AOZ:Q o. ]DdhL -25ޅ >وf$6x,)םZ[iú[ Խ+21cf,7^DO)+/ rAG +ju]s2L 4D?(_onfT6Hl'dB"H3Nst7 Kb~ԣ*l/ëGE`ԯȇ[' b_5&7qaD/9|J ̥t~{dOUOLdQ,R֭ݶͅMYtzn+!G9ZG]rg/"\~Dͮ|~Aoi_Z3W! 4ĚTb}뜪 d Vם!T`z@Iᡈu'T`q n߉j-?"cw6*)._NR{qu=U*w,_+(wO?0"W]ާ+*/r:oE8>-hd] ~pd]a / ,2vYHk#0_i-{ߪi']\c.v<|B?=Yd<"q+~*1Z {le`t (*]3й|SIMtLu@ã' 1KkhApUv=c\?ߜ+ HBq7|#HۆzeOGhM'h)6؂&2sGnm =D_tapbG1x0wd*B$A|!Z Jb$3vrj.$|ۮZ>da) ?=nYO*@ 3I9tԄ?HאּU!eq?`x"}3\F$X,pe ұP.,cMTflԡ`YڛH~N+)MV УEW+Pmw XQ>=ABۈb mוwEDHg7H3 {݆*]iU"xPL ^~o?baX1Έ4Y̲v*2I>slw˜|Ԥgk8KrZ3*,heY=bpvs Q\/Ũ+K3QGez{}kL;W,y2 ٕ֯m '/6F#T Pqc 89I'N,ls 8cp6kbJCz jA1rf\PhâQ S 4Wv_k)zmeʻjeA" U}(#U t襧jLW#j'ݧda;@ѐ?nB>7gme[YyyާOȡ)󂯑͠Ǻ?H\"R.QX÷X\K6FA2ːIH,2]Pĉng70\TnuY:FaU0$>MEbWVF|esЈG޲čf&"=~eMQ6qM`2{|R泎\mb&~B2m'X{ ծ9eY zb"%˼qV>cBr%/s2A ;eg*TfGI" = Yo7 FpOL1AYfs vrݫp+N&.^~C_+Ԝǜ4Z89,l!5y{ESTق6O1Xprs2+,F \-v_ Hm~ANPDY,a$q4T0%,&//9VEYڎ&jy@Kpk& (Ejmy7؉0U;fvTuwwe!1u fL4%-286;xSV=YRtkKY/"|宙(lBsS,sU"_+f-Bʡ )J8n!yٚa"OM!S}G'xAC+PZf PUK|2YChڱo: QkRAtd}wis W'kp@&aB0I`~pU~AM'M)gdzt,je#k81,p.'j>.:FQ; Dȣ,qC ̠棰OZ6m=mJTfOE&H:2 {1U&D˱6LBAUZ aaJͧZGg^&\O( {5VRghstȟA=6c]/Qdȭ`9%D9 5 7[W5ߙҪVۻ*t _틎0(ačw6-?&tbԃO{80#4{сS_Aj[Ь]*C˾Ԑ5g3ڻݽd +\ms2RXnL`*jl{DBvϕKJ%|bSQ 2py*w¦|2(E)~ޖKlbsc%,T[pKaA9Ҵs\yP4}?ȠxEmT ^8ԌwͰ#Y7lf.^v<Ӷ8+;:I҉Tցh؋u-oyxCr&+Q5 bXF^7^ 2:z h-|pE~~@ƐҞC)H<;u,^1-Kz8rJ H^#e0h3 p`;;i2or?f [LiSދٽ >*~9($#-Q@-Wz-ޠ矒QPH! yR!p{L؞a˹Q&d?S]&bf:-2tVURX^!WlwɃļG$/.O[aCi`R!rhOxAX,^z~=>WͿP{E\y7YԄCԽ ;MWe޺DG?AHfc>sU:.ѡ$ވ}sc4!Xs;f>o[Zfe[NP-q?R*ס.~#U)=`ziHuI2w0ᄗN-gyOC/ʮ^ n=-FpޭA:WMώo?WX<' GI$+ͨ@=1,rHMr8L)5P'0Cs|0:zʡKwԴxƣ 3k,I8#ST5u[E*,ZBFdg]늜wRLQM} !-|ۡl}qg̵z|@Ck+$MMs]ylq )ƥVM}efM#ǟabG';e 0aVlXZC O~^)=-VY<Km%`* ~*+;7 +9sOP?rW 9GDǻJz`d ³Cjg)̼!*<"ى:Exb5; 6b>o 8ĺ;;[)T F\y06L?/xSSĺ6/Iaxb("Xz10bI,5v[""d[DrڜK\@aAT"vLT4Ź J7*P~"7H&>I+?]QAVކa~C?N&(tKw:r(ĠWi9byT6 6U8y_ Xz"({3ިAlq[5L1DNÖEk;o Gdˌ_J!| VrKw>(`I<Ñ8Be!ZP(eC  }6*dMy_CҐ-ח~2]#I-{$dc|Wۻ9r&S/F-Tb1LTl~$q7Djn\s;-E}`ȣLg=XƨS'@zlG#UƜGnx=?<3J*s>3v*yBBYĘ8' %yoFC4?ŵ8i6iXxbpma2(jފP3ʹ)'1>̳K՚ߺ]Z3v|7kKAԶl?J}!ʘ4mIy:Cm:v<\#Ņ~/ O )+ːe.waQIDE-],A,DQ*Ck Klj"hZA`XǬl6 لn Hwg8qũ^ V{#+̄L0AۚjmxC˃Hcjk3.ܰW:OU3"w)pu˳6Ⱥ@/~ zwforaF,ũ߫إ >V5oŬ">oS<67.pi i$YsZGJ1jӗkqrbi t~q.Qd X-o{tlu)x-L]E:8}0ڡ)t"͜vŞI\WbUpPQ-:2( 2(Da F+MyaS|_pŏ'p)G@ #8؈U`A@qP Fz뮧!NOG^VFOӞϻraLO^0瓦K'X ?Ab=Ic2-wA_1 wf۬1n;~?lEɄ$@;Q҃ě-Vw@^NGvϲ.[FÝ D@@`nP4(UaNӴ-We"p뙦gT[@G1 ~?ˮ[U~~uv*pfoyԦ䯨!#֊)!J[Ӟ 3[y+r5CO/oƧ/4v6‡ԣ^$hN%E ߧbk܂n-KIҘ/8?.>K/)z?1ISAF9hp{K8/Q'[~"! SCԌ!y~޸yp|!Ds6̵tu=1i?O42{8&`jU~HZŮ6V^mᔥo1-v5JEk(oHi1 ur(sstTl{4l71wX50)z%CszWcӖ.G;W'PKCCӼHIM*G,09ed?U׈v#E6#"ա +ԽKaO.6r|^("Hgn wpdmPDHF׏wY&ĮB>Slo/pV^#f¤fM8RaS:5gE0(^$E ֱ4c 9nל,-/#6JDR=-/ZC@ 9u1^\ VBu9xJTѬ<󷬫p\fa끝/l`@cl=(R2KjCrh,ݙNĖP@kNfϜGP֒BjXy`K)͇O)#zAjwJzNY=[3yҍ6=7!|@h[Y(ߓ@W< bZ0]=Zw^:/4GU(d4m΋" [sGК>x33Ud=>ZBFV-zO$|u3u!~U!? +fݩk>ØGd=n';H@ OuD'(I)Xjv&@ùAn٫zRPf'o֞~{rPE]?"djBѸThO^SR2-XloH&藛٤ueP2 6T HTӽ,T B!ʾ>-,h:Z aqHy//?^vq 7~\>.#-m22͜h ,<=G"W&de7VyV\ c ͡;f Ւ@y BW9t &*W灉2096vr͵i,Y\xza'ɚա,UEV3J ^Js;9K/i, žB!iB Ж>33m}HP9X8$g!KAî Sqtv6MbDZ#ä{R%3?S=F-2d`t iA!<ԪOVh4s#BAز_+U~A0kQkZx8e~" pI9jЪcܑӪ;DŽsN6m\96*J E*%A)% io+QPȒf&rDrcmŀ5%~\聳a?\Z1:C20 +a!͋WaOH"'4*‰ geS)TT%]CCRؔQDW v̻rE_@ys?Q_4y%Dtf~:S9n(#T,s'bڃdc&/jh,wh̤dol<2@*mFv4)o-:gG7bnv |T.1wYHtVz휹M|+xkup.V;w@6-8 1Gm+OS)}Z^DK+xENBŊ3;KEN@!GM Y>HBl -{eG}l^o̽{Qѳy2ו6#Th;p"l"uk K+0:a: + Ea*?͵TS3bU$ qO-A'o##cwނwN»yvf!9Aa9{I,^@ gJQTeZEn ?NW@gf74kK41X)p8@\ye _!b#\Dz]U֟Ep=] aO sB Hގ߇Y;>$[*hOX\x&ywYU8Ԭ5ZX3x ˾m {s6oyZ%v@ՉhM9uafW妝~G2C],#C: ocLb 7B[["ʌu< x]60$+EB bEŀ߃f/G| ##P 47A_k9!(+)׵AJE\a@oX}Jگ{8˴k~N(Ԫt-3N4H5r-_jQz @8"j)Ɉ$([vr7,v@_U%ݏ "d9pZ9=ˢk Tw~zW.wѾrBLy2ZxNہڞ>Wt?", ! Cq~ktqs^c2L@7XMGBd^,E1q>0ftkYfːװ᪨N} }z [J&g(^Yiﲾ\L̤0[c :cxPBG,J]D9=T`_‹ωR-º_U]@lQ+0Rxr2ފw> W&1pS<Mq}9AoL4Y zOdZYnkagk8>}MKb`(^M(!W W_o|Pbim%&ڒh3rǰY>gyJVKugcNJ`cPz [rl,}~P+V3&$O<9RLa YGv2ʯ=+cC*D5#Ö 0 O5*3r{-jQ~.膳MR52USء$I2x~ ɳ#|; &2y6/!#)$'(U5nqo(|.ؤoy[YoJgŕaE Jhc5OXW5Dbn_~[kY&pι=WP]\gǦz97u # `*eqWi jPosZ/P$M*6l]68- Y{\:Cr}ȵAHOB?h똫^W(bᇂr u)!==Fa]8qhgqB@ JiH/ b?"Ǣ1GŸ@6C9ì)SK]~SyAe_4;T$'As^*fb%?z~jv1"Znjʁ ' s%[q2(uJ&1oX6v̑-՛oSW2odn\m/HTЋWJ]+p;Fw$ëM (\ѽ(゙y| # d;~ 5qJXڡz]:%<X(- VQ޲냲"0}eJԏGG oSq.CۅtS3OB1#L3rNi& Ϧm&}S:72I܆ cwY" dW(Χ @#  Ye4|IxV4#tl(l:| btHys` 0ڇ<1{ʋQb[[Y=G{tiϾ{'e0 Zprl' [~,3`sg˞k@>;- H8ѵ.-c"{Y8\gF,MT'&Ýt\{F-qQ=57ddֱmI]=@GIC^PkDpOǟⅫkU܇CijL Cz!|rR,H+^wN v- .m_R-ݶL+)mǼzCoF[$f4fT ?#޿fK8Ue!oPo% dd: nYzgWRZҫt#χʥ)FD۬ص.`$lW` =ێ AUo+K םĻ|9lT| pDlOb#9Z-i2S`)RIi4p%OB-w[~p1˃~Þ T?+;.|+˦UKG0QV&i_Yl&f#!o[9g#F6q*e Sh:h͆~Xc~-@*\P)y$m}*>튫"nZ^P06*g;=H)8sbV2p.ߕ!$LONvV5k=_ Ȅ*fFjWB&>'2A(Yk 0&d -{Us,$ab|q1`Wͧ$'!̋v(lI] 1i_/ 8$ю(!`ǎm7>{㸋f0B1Y0&>SDeөDu`iV#ykG# @xk9̛f4͜Fx,Om@DPʆb_ȅTW–%$'N;V +K6HTbm HBV $tG)Ok Q+o+ɉMao@{20ү W,{?p,? Gt<-,YܠBɪm߳_5MP'%bt k\Mǵ5wNJEg=gTd "1eg밽9sуX> bX?м7@NRõy'0 Z H*x"œwڑ3z{~ݲM;ķ᪁*\6j=G7a mD-K0@ 4sې{]dqx,H_z Mڵjc{2!Mw6Y`צ8XQ?U49U.0Ն1JjDWC?39o|:9] r.AX_pd!h0m poiK&: :Hv@NԵMatyig:~ p i 쐗;X&lr~Y8TYfC$y Y̙CGO2]n#_ *eo9B ~w7s2'й$hJNbT3aZtwʩL6vLSza|K=6H$L~n@aN\oLAYW"2GTON{O~+ۂb喇$% ok;U /g)MdfΟR])W]F9LL14;"b߇6#D;V8If}*#ED#wBEY/ve9ݼe4琧a8x낯']~q<_$7, -+ncRn?hS#Y\6NS{RI +xoLPUM2d ;x`(V͕Cfܮzăfa0,Is#С_2+e{x-mw׵7O&%*!?=(n8z10zUjXRHMQ+9&"gyCej tdڨa1y&}`Z;8Q෌Qm>}LiA5SG@;h詋^\r3)Q{; C7F }CΔ`&Uv^S'1G[ DBI(!E-P ÅpX- ~CB  $oVԿ? mM$oRRYmXӡYguHhgu뭥PP&37:ͼVj&+*m:,zAL0 6#1YQtiz8 ,)ƢW C$ۈa>t`A-45x ׍Z D p(1vD.%iɻ~d:3s`R4nLE=P*Z~@R/`%4TlHC__/ˇҞ_lObY()EPɺ$Pw}AΞY6n: a8+5lVN]= _RtYB KAHʓ`zA/% M7EĪo t/,S# \،G}st`稤sYw^zY?>B *XV) ܅ÄmtM`UXq);efS A $ܱ77c{h'Nw #Fުe<"r5 >N&y"O`X)~{ H[(idUj5 PX+Zvf uBcI΅Jurpf?|߇7IA$ 57N2&@`$ a4o_T䲨+=mSƅ'$ņy o>dsίZa HHO |F"א+UmN7*k~i3gfk8c9JBg9hB븿}x%8#cw$W5|0N8pQl.ٕy4p?q6Ls l ւކ4؎ʝ8~Se{C7 :}4K9Z3R(wY= 11f]=x…+qÇeDa0w>4Rm ]GB6McnK]L.Xǰ jqvsv<9#Х!M/*{;K1$ˇ>5 11kz7\^a.L.;F>UJpmt-}v" 7?e\NkY K-j(t^B'د|68Ʀ! 7Tc$[q0)k+ *#B͝YO@wIJg/Lj|H\߈F) \]kKXU:921> 2\xX%,xCM$љfm9r\żcM.ɞf$kѼ3̸8k**%6/W,otЗYVTF,!ԚmVJz}NTd'gݱyCtX=UF HpNK'^=lc[p(Lf\b_|3RhhS|B S9gK˩X@Tw&ҏ0 ]A7G9EpşWr**䈹>Liyl@R [EM1(k7leY5Lg_29ymf'6\="Dòcr :e>;\đ754}x2p*OXA$эf4~dHȮ($o+K2uʰJq?H{kMɤ^߶|n\'^8w]ww^qmc zY4IRcaaceD TؽyڽmGL/"YPZ%wF Y HOQCγe@zsrSIA@1WDDAc"u&mxi9@:'zؾL^CH5(?#u1FlBzJJneDH"wkBRLRIЀW۸ZKI$Vf{2_D [>%XҜ0{'P F]<f|Jm&BHL#<$h ӗk9+(#ɫ+"WUN# D7:n:/wGzP+tz8~ݝ;{br6:Y)_Dfzpv !`Xt;;=7yK~=r4C lP&S)}XaIDځ(RIK4:$x R 43^L#N)G <\va '+`&/kɜ!,Eܠ97<3qԯGǍa\.BdԮ0#4X#fA, h3.<̛-YVd_IE*߸"z3(-hY:}̠_#DכM2d<<"SPIa[4bN8 %eZDʴ" ;b4.wFJ9y_WJL4!@]KU#O-{gF+(:Uvǖ%CTQYŒQIg:a0{F O4<],O;!Xh$t+!ԅfңIza:;}졯!/[;9 _4‰NsUj^iR#!uJxsQ֑ wXjjrY,o{dMC Ǡ,e ZNOh_ k_8H r3P!ޓ7d:#*XUC: U:pc |3͎P!Taրᴬ3w3ԇI;L" Y9 d3oBQDڛ;XδAR!r*~AesĪK9"۔YqCƌr $ P[ P*o/WV`0 vP?oٍ!ga 8'S"OS#fŶܿIֆh o>zwN0ͣssO xpWnLը>:w(1v=pB*/P3 ;qMzq7y.T.OzӔۃ;W']+ neTT1H~;CKS 2˺TF8Rw@1x#R"KnjP9%UyTn T<}=UUH]d9dK@:_@|W ,E >A܍Y J7VHsF#Q2 ϣR[qn֦߱bklj`Ch#[`,e-Y 'P@Kr6UgGՃE]- gMsb՟m)$7,L,p##Kۀ}599[k?gpT.f$Nb+s=n\[}1s;7b娷- r4;q:X<aGd9 kkG Mu!ˑwҡuLs0vtC=@'یCE|<8Q3PNTw: FI JኸA׫y@;ÙnQPc" p]ɏ; `NEoXsw9e=|%Sx VXLTLwBuDSψ8WrӺ*oy1 P``;bhrTbferdž2*xdg %*-bT6E3ml&ͳNcVe*\V7RtmiPl$yKM;Xwk GS^Qu%lw#@=iЙ%=p@AթyP*m~5 SL>&+O}y6}[9G #.9J7I+ sE@jR49Y'Nא=`YNkrḶSb,%X~YI@qޘ" Pcdn?*iUm EB@+{G,{vhC7/&e6ˎ1z`Hv#:H**)FBr $&Sb NxHhЩG5e}0fHTeC|k>U'jvaȁ2qZ,'Q żz=/G?sO"qY -_'I~JMG-Wu,K%B߶gl,&O35Aw=% /= a('hk ZAN]4QwI%IrʝȨ̾4+\i} $2'?r1̕מc`e Pj(iU)Gg>7ś!N2 ؤQw-M v2Qdjm Hy\1]JURuT=J nCRˎ2VnW)Kŋ=;'\NTs;E_kiDIs1?6!Н:׹H#bݵS #짌}plS-6W,=#F<=n]7,p\XSbstXȊ \{aE51x|7t ,aC|"( LpF$w*-xw$?4}|]CaT30[mdU5-hHMy"c4Nl8!P5cHa=|d8FAתJL죗. U$;pLyԶYj+;fn~]8S0"_yʨXĄ:|;/ Ic(`l}wl9DI,`Zl͞&FQT*HUj;NF@ I |EKs!dOd~~Ie)!oÏ EP"F E֎.ZfܶPTUZ*_랮P;U>dn[+橳Ѓ4@}78m%M@Y +.R]j>"3}END-;}G~0kL+=ߣ}"W-ÖBb}>]:>9 %O[%r㠜)X2v98 {Uxίra&5Y]Yf0=.Xx$%nʴeFw+l SC#*5J,R3pj9בIQĘu]b $ɭ.+ZvHE=Hİt5OmjoUxiTp_QSx,F"5KowZI ħ9S|yM,z$~JUV$9R7}o!u99^ )-啈sC->PKIִU%r@6ҲdVqɊ;J9yY+:&G6vGu{2~ujy٪۵Tl m3H1Us#o"wbyfA} G.>"jp~iI@{S NDq~7ϣ?[&YѠmA5!*$Gg-v3hS9Ꭺ ?ue;: BA ꙑ,v'rܞBP}fu pTfΝ,ǀ0TlSmzqhinʮ8u]3>WfK_`!QTkFk.17xBӎ\s^()Ʈ^ֶf`-KD<)>. ͐ß'':*]6JʒFu r si5B#OЖND/6)Q,P^ ǼنlZ]6R>0R*ah5ҿ2ؼ}v{?nגR X&_?lh#OJL-G/y-1GIb f|\J*xZNw6O4)]m9/FXB=qpI#A .SJ N<,?lp@s06+{$f0moR$VRg߲MVj)E튪}p ҍJ"D(OFt\mB EOsXT!i-BJ"?/SVϧAz£49PęP@=[Vʙ -vǰb0@K4Cvjqın( @Rn9콅#-wW\9P~HIgdg{-'UF%jӮ+"mK֒@l d\D*~) z6`gSNoS.O Z)"3WM-&^BE`àX}C$&Gn +ڐB}fs5'.HzTmX=;p08c^M_EE`zo7oD錇ox(4{ .Cb9qLXVe(^ ebj*>nYQ<o-8~)| X:zu_60) A3XH"xm7aD4<}  U\߇^]|wY{.2Z,q>"3Ae=: `BXբ]k Ld1VlWUmz@=|m{ H$:ODK4:D#UE@ÇMjq;BPwmLfT**}xWCv_[/Cl/;5 ?_+ ވכyĔ} ""0S+ɒL6D1USlUwlɣ>NOTU(Xh~ zEO{Y #2B _HҲU}_zuΩs6Q mKq>ehJvzĎ!(æ &XV4M6.Heܲĺ88#($\O3HJ$Ö|<'):Sa6=.<ҥI*Q~K#zΎmfX:̓nYAxM?֓оT8ڠeK:|R4`IU]vi8v8'4dy _Qpj0bԬמ皪7όߺ=3v̈́Pv# HS+m; b m?-o]rRBv]?g4E|VGsevrAe&r]XF|eF'=1;xI_ЂFŚH!;zHSٯTxɾM6P5rr-+$H-3NG(Zw*g6nL~AD{<ųK#QI vvM2bzy ˻}- O @+$4Z(eΨá|VUM(i/ej{ub9):@g'9/ N>CGv*vO -ZcyK7"|}'F>P?2@(f6gyh+xo0ҫk%2 "ez[Z caU*ǍK|Kuqzi$}`\^Њkl5$ ݵ L|kLop?s15QD1LNYV&(~n> ]bFt`q^A*U%B/+_& \G@D!oHSnXf%9'(Evz'j3-Q;2ux|reH: YRD$5tfj`ך i4mжغc3Auq08͵Uכhx3=yRz՗}dc%@S=#:kA?v'??PBSYč)hg<إW2DR(3Ix˳ c_VH c s&G#L7|{nc{x @Đ jb\A$ۜX+⃀@^2yNLOt2Xw[glSs7B#쎉}؂Yi4|sW%N2uNOgE#F#iY?e7owR>g]F``ӦGpᡅ(8)_Ļ͓zڀH&HnA-V;Ã%l&aaߊFcWU )JWA0rwN5h[1Ra"Ki&K~^X&XW)􂐎'} G^z>jکn9am]@C3̻k333rs7-k{Mpu@-Q pVs'ʭOrEy`+<޷;m53mM16 +ֆ+H!*.B:~?A ~4Vt.]D,!"ilN;`w*y!.EcqNl* 1$ GJY͐{Y5O4.E!e GoE3;(`ZTu3/^/o'Wܖ|M؍P.X_%NF/4=/u={6p+ wK86`Elk;KH^&9.U1.j$>\Έ7h߿ O\ |eלKq]?q.ma]鰓`_1C+"b8Gsˡ3iP?+lJQh-8 1!x{!EVO>9jUT&W#"~@פ3MVAl2IF$1s)pk|!U컂ps ].:գb ed6h7|fd U3gnKq3m1P~%"Ӫ_~бQ#c/7g )qb0OQƂ?\.k: Tʬ~uEAJ\" Bnw]7 hĞ@PϾL47c,I"_Yt%v2_^/eKF@BK-ރXѕ ~Uj<q" RosuZN&A^G9=~cxafeLo o#=RN` ӷнyk-Z[w/\ Pֆ?fыQM-&?9wDGP3 |<&cx9vX-ׅO$GEqZ1,Q+C}c\y/ңo3V Ilͩi^m0&([}qEg3 WVxy4kkCZc?$:TiYSfD2G ]p'd`LCeHE$5&*O+֨ܞ;lGs5#L}-\{_Ak5[h7l<vOoK ةɴr}w0ljOu0-[=Qc3+  kɫiҜh4&#ᜤd.q=j !Pot0,7*U$ᒂ6@ (ih>eWNMLhVE/ 1e,wifW^r=|E:4Yl,1dGOؠo CcIϗA-6 $(Br%TQhļ\W,B͘g6y:̀EщD`Ft\p<up=K͆KQ0K1%g=D9_GЬ5@;^ZkӽAQ+rߚh%HGW$y HVjv;Ӻ;Q9W":?ل{CEClM xT`W6/d0N:)2 xH:3csAEwo%aߦq4Az7{֎ }$Zg;.g?H%uI!<q!.(&)bo PxP=7rn۶ϙf=$ -gD}+#tө [ќ\8?%T-Q̋!_<&nS:== 1R^Y:1(=?r"v *KZ~P.֧6HtitoE@-w8-"?+΂f OdML]˴1 xQFi6;|&FkzA&Ni-* {NИHǗ/VNݖ׏ҒǽU6coQPSs6em b9!&+E몁%4:oDx?rXWq.U,nְ6AԎ>Q4K ʌ3)/ ,~+t\7ԥxBH;>?%'fSL`cKǂJؐs'owڷĮO55$1(Df۲߿y4D >6ӝN4qyUMp/Ȉ _ɨRh60 胺\Nm=ZrRHbGe&VIļ'/*!ip;@Noo~ZnxU~$QM`| ;Z47e}Z[fS?6hk~k%'F%tG3i>\,NT Jb[ʦr.}ڋB}Z7Kpw<ݙ|l5h.3m#ccmVFw;=fyOddޒq>s[j7C+]:̂ cF XQ:Ym(OvP CrVb¯S" \cz9 SV+W#X^R1<FT?D"d*\y/?"f2h~ap;rK 7 B@&6TeSN,ΙDߣ>|"4RŪz.b!(wأGȰg*:ЫS[gEIP]gмEcmC3fXeGTA9| EE!_\ą 1& N'ϓg 瀪1W5-L6\Q);oMߏ7c-M: 8Dsܮ-ACs^ہ5<( R9Iڟp>SIU“ܲH{`,hg"O}Z,5ݯ*A|u*7,JI|vjhH0rw 8kdM!HuW) O>P6@췜@}&yя/f,ka|>:Q҈{w;{.fR2J.]S^8oCeOgD;D>b|lMVioSX (^F@eBt/ Р$`e< ]l=\ԋvıq{킞L Hz#Kܲ=ͫk4 b}Ҷ۝|~sc7 fŭ``VqH(GI@w8c⠭*ϼRЧ &쎢hfWc}XRߛ؋J"LU1/A0'WP'w2;y2T䮸?)]΅ur5 K 扟2X}69*Wyra98b1bcёyM7b;xAٯQ=r|?v:oL {2 sXV< >Dt2"7jF}j(hULnVTt50f_>m֝(K]|.\j-7 +|#j[F?%^O }߄PrIz:0]92]Oc Jma'2-[eoT^<g^bstp j l\rYqcR<(3K.9&+,Yػ7؛frjNI5 Q> 0$S4~:ud[tf0Н@/͌&@~7is[`.KILB*z'nh(]nt2tG+}"qA `XWӶ㮐F=(KMi Tƥn{.ndgB'ë9chm ɼê87Gg |dDKO'$c>=*i2LZAmEyUњ5Yeo0;Ь -No@u1.@ss 1'K{-UXQ%^}لv8bu<9 ?娝5%9ޓaqw\![.):~0p2yKG <+yYi3pז1u\na:۟2ŷK 9Nc.Y&כǍEð,V~TD ǑfHv0.o2Y~> AFM;Zie} u?WϏF.J}Xs#gg/# L7Ŷ<)wa%J5c!I~*Lg mܺ_ ShuJbdcuR, }ҹKJ籈PU0Lj#gyRsWs?VJpDVUu5h$q6aF s3Qi;MOu:釃 I&_$9e+'Dz@f{ yr [NF&4/2Lڠ 1Z0%/'ަ;A. P,Թ+4~8Â3CF9?rij e~$iCh,EK:/> Mrǚz:[ͭTa9JvU|"$SF'9E.t#TI8+ma`w*fXqRtQG.$NY5S)xcu'^9֕PqК̄r#edz֖փ,#W f[ON jL3`Fo۵ Bޢ~r)z:?Sssx4?QڝmǙ}` BQ 5#umXa+41Y`^#Frϝ K4~rx=X+*L sHerF'w[fё5+-8a[ ¯|Vw4(ȉrϦͧl.V%nL5y }Jp?ߛL%6?:E/k~mYz@QWmd\yi&dBbE66^Q` W .Ev Q@bM= /{PW G47ɹ\7%#dG~-D=< ͬ<߄Kihdp !SߩOq={iCS!D# -]Q% [ofD|r<֤D\k kT|T3 z۸:0}0kЮjK1\lBJSj,҆3k]_a# ڻA(yg~P\&LH sر'a_IJ{|zolN%R@9`h֩0tpXV\ A]xNVGn:)4%̓ 0GfE<Q]npxz,ڇF. s$;HNR՜E:t*\(52ߨC@+,4 ?tDߘa[)=/2,5 Fh(),bCA:n _F[H󌿞bh!Γ2H>JdNO)+MjWӷ9naɍʡЉmGvU`mp6nzvrvlEVXXeo'g5]ƵypX,Ʉ(c`#{|کOָP:Z `ptX='T]Z9usJ)-]YjWҭ;d -@ʋuXWрIwtfQ-e ZMpEXj-P1 ( "WD)d_ rq껊eգ%X/sWB.3b" bjDт3鯕^+4(NBr՟m \Gqo C?j/.sU7yYy?:0~z@у*@e2OF}ܹĞHݡ6yF5S (.je Cqe3Xnj QXF0-TG={> _$B=x/L(@x֭+\cBln BM8[-ͷjNRH^.ylJy/:]>W ~J5>% h%wBS*?D6C H z.+q\f?$c/>s)=%?=A va:m4Ni߿<,qa2BcDx&KeGU#wsI =~5'&Fq|A^; n|7BV31|bݱi Xkn޳pNv ]LRT!:rpHč0]` ݪp)HjwP\b<jiǜeQץ\1#, 7&*.>Kdm? B!F"žhz3xAxY=iRs@ odz׊11t&ΊLGgl_7ug@c+OA10(O$;&,sg2ӵ2[j$a%/~jPS!ۭvW\4|*&\)rfF!Ec BSsabݤ_YaD]>6~˶vgd0Umdm0uϺ|[]׳pIX|?-q-DSnM Dl󠉔35bW׆%;?CReg&JoUw]N˸W(LS$gp@.",P75؊XaYf_J~ȭFH?){g [Hy f&i*$u`!I K>ʑ?We110_wz5?lOǧJy[Ըѩ0{>`rJ5 aMGpCsϑ2 ԟ A=Rߧcpefۚp@/!3fN_NvyT;#!\%nHWRyP8@vb"0Ȑ|8"MbA2QHå0v'7Ny;hMo.58R2^k~b8Oi~Fi\| ( EDc=wr4 8<28ďd_xI~l O$\J{+~}+V*iF㻴%`:"4eߘp;bqN-rZYYP8kfIW*քI6Y1꘱Kc-{eeP]VЗث^:j#`c1S+)' k6LAC\SВlL~i`U})47'\_BlwO*^h1=dci'!-pWL Ic15, ʥ}͙N,S%;<X %] )@X~pڨ<-#:1 t~e$H`P,7HJ~jwʽ~@BDz7yėG~.lָ_xzysls0jу_flm4{6?ȧ{$ѝpDKpfH:Ơb'y(f ˰~7XhNm3X j" -1UgZS`blA+KDPcghxI}M+5cHל3Ooh_HB'N4-a_x`@`or8qiF }6DNzѪQ][ہha1k/sSvDkΤ;]@̼r^]UWp=PՏ3>{g^D}XoHSa+IfjATz"@>p&LueJ&zpRX;`_ǻ&ڼd)ތľC/X}K QyAZ#e5Xt}h웊"Wu)\<t(awJ~`3LD{a Hؗƛu˫SuI(LfP0ӓ> WEIx|u zԝQ{ǔf>k;T/Vo nkE< Hs'WyeǞ =0ԖO_f:&;)4rbf]ګdͽ`r4.=V[gAQ lǩTJ cw|lݹ̹FzL]]$1z%[v8aƨ?c[~ڢETU(*ffM7U`bxlʨIK}YD0ŕuBV#wE&iP>[oTL4 Yʎj=>Wr,;#d]-I%ݒ-~^ l\w@9%|Yf'6C$4tC-yi,umN̞^wz~H iQcACר.0|@kSFc*gQFnD3|՜ U9轟Rb&K_a'⦾Mo0Ʉb Nwi&:6:=2/lbPcfNP+CU$$­( Kb̏l/X^^ZMbGSD]Y]7\N>#3N$_|FAYXW}h6 hMF*.L|+i,N6hƟdpLfjWB0&DݗxhDHҋwU/~BW9o`p^BQ\P.sۿ}^8倎KNn_8>?KGzMd-'$/v *†zŽ$ =Shb8onɂP@wU÷2Eqj3UV5|O h|[ܧY6 0gipyoITI_ο]GpNקlMxuQ5߁8yӬS3@tujڅ^G( |ce~8@6r^SPIO6g ǷJtT[)G_JhFl=V^|:aLy_NTt/҃` XHu$%8woww>$-F~1KMp 07MBT+a|$Fh|b`ٜ0dOGi8Fr<Ѝ.ipDoxmQX5 Gfp\ҴeZ͓ ޱy.wS4vWzfۙEԮ|2lD-jFvjW;hOXZok8Vy_MUh͸b:4=)[YYg4['6BZfoGUamUGJ2N ,$|ƹ{c4 PA(>FBv9cE w])RryU:8 D- aэ<?CX?2;fk-nfRV#1p\oy<,~"c(.}fg.0йjg({2%sIӌ/ ѡ- CǓ+|s#| ydؔRg/DZƻI$IAxɿd6Wt[E}lWH!ej9 wQh,<ɲ?1n8|?HLR.gQsj-(="newVRGyFg ߣC)XUdkO¿ڈbІa-Rߛ>8BT.Q+SD&/,u6S̯JWCQuUE# ~DžQ᩽DC $zy8䑍FdHY?z*T@y`{]NHIĶG߅9^ 껌c:R`%d um@d)MO'w5`az=n)y+l9Paսptlq"c*VJHY@,u"&_F /q7{{D;!oxI}yM5;nՎ=]*J~{O*H+Pb8Ayp^.#SaHݺ3߀߼9dl3ww[#~n,5ZDc vҮ/2$"mcFu$XeZ߸Lq 02;-VqBg:5?D.Mft;6))"^6b [ko U~02cW?۰3 m+}"l)(9؇G0֡Xן}d]@2 ?J^Gc-wCǨXSh~RREnv[)?}{|5<,6&HݫpN"}ՐqRSà1*Pv[w~~&JS8 aÇ>6kXE%`vcGN-)6gLSu9cV1 ˝zS- GvzbZ =h8x)7շVIZ3ᢕg\nr 7GPi~2n R6zaP0~Kj։nm gSSb\ȮItLIr17r\+wNeAȨ4ee#*M7w0rX|C2f*IXeBT8ϸ1#8L(`Ez?^sDX)7] # 2fu>%oT،GZglԙX3t>x:W!pWG֟ Bn<\m8 FrZFd鳩j)M>OlBliЄU`Cvjss0Ŧ|Ll$XA'Sc2PNUb"HYջ]}5;NމdDE[hMYdT-Jʤ~M iiKO<+y&*S<HL˘'7JeQtF?p_^'OaZ&YoϨa^\fؤʬ*3YT [>#>8~ْ ̬a^b2h0A oiH^d |5cN|?b}zQf8I(0<*aehz\k&pڏ@w=Z֘](6P?0ldA&]bb#*?P7$Eo$07ga F!lV3Mzc{vZIqקw=[m tWvQ\55e$/` g@= $QN=~ 2O Lۡ & Z>6‚ Dys_vn 7Scmk+{zN~@;^EjZG;!ܬnTi?OՍZ{#|jkg?_Y|Ma:8e0<X%utg}~# y.`UL@#1&R ո!|w}G|qyp7l&/R`o#UZ(Fi2@zdD 4[`L1 `v/XfP#t6cyzrjw.t> ^)4s1r 0`m% $@0}L/ A-6^?o3ݱ?#= АhgM=P,I>w{wM0=E~.xK,%K;JQMF8i7!w(ܽ4m߇|>>|> È\uMd1 ;}LK|?~:J^:{sХUTM'WU{.{.NqS}6Um!iMV ୨27Nguow})_?\¶[4//M|MelGxo% C2dF` @ߺH[n+ 0hk]$ $ , ;#$\<#}EF}2'AR0A+!ycw{ci sbF z` ?[phB\Y,~J). $?rB4@5'r^1 q$j"(a[b\-Fp=-@S/`~<щڊE]kƑ4P%ۀQ9^QǩoW=c8kD p\5ZE_6EAB6R$f}&qvvYSeMm7ֈ}h8X8BkZ! JZXJЛ%سy3pA f.F;ꁭ=ztjE|=-j9-F@&P}O–TQgCkqgJr7OtvƐoO+T1))-l<'2k/pu˅tUH;S" ADeؿnV_ly{kIfczVZIA~y9wN1!GxXxs|2SgE Br=F[#,onPeϐ 07vbn%?ex^,Q{1NfoЛ$_?}tj.O !(ϣz J #D0 nD~cWg-#2 44S?lZ?'@8In|v6^uQ3F=KպFhB"2H""OF;k>h}B* j+y Lُ_#'a< @o~zK\sLiwEp]xfTTfH@I˗c!`'/ %t\{QeH͠6"g5 -sV5$B0p& XF1Xt_8qhU]@Th"A BH ;_?=a$ |>vu%'/@ &)̄ 6J7]q;fp⹰+`prJtR 'EAt1닡ᯠR)]vF벥{G]eppٻfn-f2<˺ODXk3Qdo]vu/0iS+cm<= a_(+2~Pd%0eR#%S *b/{h^N#b5N=rIAH{T "XB|cJ;J '!!FHk*-oGc{`7xvxOFGIufVN4WV0ڀ[*2EӦ22o.S!!'?IMݷ)rz<E$(Nu)$ʄ&82;GQFI@O$QTLDIivC_}}lF&k}ub<("r3UPФϧ$yک0Ӊh<c WDؤ *gֵ; /6U4#Y-DEE6M"ŢJMJPS\7Z)JI$\ebQ@% (J(MyZbW4l5 G J&@@A0lRr /l.1GG|v83)!~`T(#]C,R;O~ċNq~Nu;߀|ǵ /? SeYﳚ{~:=2-fj+=5_wVtyv~A3yݟ#-Jd}¾]oϲqom5k/ hL:!>&K1mI-XѶXY-cZ+Q)k&([Rhk%TVƓj5MEFKZ4UR[l-Id5XIZ%ы%XAkH[b5%%&JeMEIbڤbb5QRlѪR5KbFTj*ԛ%m%ʹlVUE($'a|9(u@֖}N=}t4 ,Ш*UAF"-ƈ2!r HyofelEιBYD `h}6e0CBbJ+-Jpʂi+C2 62ӚKPj4؝ HTSAgQBRrvލXm,̃08,ݭtgKb X̍ѺK/Z%3h~&M4#u! 0kdxxY΄hd "W(.ɡ:|O"à34a!lru:.X!V % kLGdWD ,c!|F Ap!szOV40b,;a5DQgWGzj=4[=a i/rݣ:Rhk>yUb<%IѲX_(j-ĪLن WC)"9cuYC2 +LU$\BCr%CzK88D  'Z a$Yh]#Pdb<  ȫU:^CÓ6#1Ҵ]#dTGF$CЬ'%b,wرzݐ1o}oUp&I az(HgAi܂P"7f*!FȱUD&"Ӛ\T"n#L3bCb"DJ².WR eTPi}Bީ!*P""/x$D8 DOEM+UKz;GIo^ǙWغK>}~҂Q(Nտ[ţ(SaӘG>~N'rVFQy6˫[؅y,X#'P ?:Z4KR| ]ӫ z ӾR8RJRVr/}uD+{ϹV[ )oozjrAKC}ظO_ktC20@|F/lȈf#)ӽ!\Eg +9y1epOpbV;}z8-}>sj;wYI<¦ѮARGݢ Rv!F1Ne x !`٩gJAv93]P7]_oa˓8ȓVwZًVg"Vèf0,2; {r ^55g23gxbz{ȷ U^^]^$合x%2BBZHo-l (Twwwuv'H0. Xwwv " B<5+52I%R % 7SusKuu5u7Hr(XT]-u3fᘺ1u au@u5tz Dm238(z`r_6iНf4 (.'өgS,jZK'?arGRN15,ACRvIy׍EK.%v9}"+5Pߧ󏧀:D5c25Ea|NfcKW|nێɏR)V3""!{.UÂ7r%789`2d=t 4( %DM2ѐ42`acU,]i+Pñ;s+~ mB={L?qc3A 4)\ω HQ UxOKR\W?qy)V: xZ56i&i6= ZӹI90M%b%iǟ{g 5KD%{'4T:!{N;Ƃx1L Ƭi `A{A IT> lxc~ #;lm9~ZW^+0ع*껹!I0d{NbFY 芤6I>(ѐG"[b Wy IR?A1KX 36^3{S|JkJr?Er4#m=s0ٙjra@Xi]Hz"|?wWhW~zIC}Ц ăBV*ѭ(UʹPDV04 X_S!V̎UU̱EaVfLnVZlfm%L @A)~"OudCBCSj9`[ػ,̉a<OE*~x[;m[" Pyri3iK%>z8_q켘m:0'dޙ87zT!tkZtj9q8`k;!fv넘7f֞z@nP@#s(di+Ջw@S̘IO+A vuM'n{M dRf]~wL>ҋ":*A(!P@~;±Ҵbd5 8x5 +F#4]r7brV5 eT+WT`Z l낾c&~x˭lF ]C={f>mWmH3\c_R- eܡ9M&~*_GjJal7X!ʽ.7 c"s O_c\+SMbNsi+6N{VWbu-ԶAFmR/]mK/ЛFWԻ5ftZ(C*JW+X9Pc i7p3<`Ohʈx9iLv)~eYZ8-[S } &]UTRnW"G[E}Hh|xaJ+Ϛtv<pŸ[_[UaXf\f媺dJq6(b[Y]V%Щ ZP=Yª*sA lYN. !]N?? xjÇ!as&fJ"FVɬ!n=.O;hcDe'Wl+֬|૨ *C 1Lgu}n:P4?nGxp0Fv-SVaE@YT ky4k(kXQ,UrAQX4ښt''p~_0Y?QcÛ6JDSREzdZ>u6:S_y3o ZZ(LT71$dUF%4 /#٫!Wgx&-=?]aڥm[Y5Z F?u4Vc{9DG04V[1[F2zп2 )$` noFQ&&=ߏfK Os2 _'~yT@7DA9wXNt%gØ;)_BTh].*{ؾ7?5K%@I"5wm?v@5A{ ve)9y^t,ItsYzH ]`{'[";T_g2'} p9)Pñ!i?rXQ@GR{0ɥ>~L"lאc|$TNOpܬv&ݕH&z9H]}ҜCgU`ڝ Ǻ;3ل4v~vt`@w1 1:3 eu~/̒T . q` @XNӺΈ69 s" @7kǛ@m@v6yg5 (!j &,{pH2̠rhxx*n9R9o>x_7 0 hFQ\¯ uP!AչXi`3_NU=7V| ]C2<#MCE]d.RmDM\Gv #<00>~E7l;}(,!_2/0 =KT9-1P:*Jb8 ʱx()zBOz]i*~;n~#<|LȂȱLs[F 3Sj)RvMޢRd~#Om»%wY:q><}UCs_Ylh2y0rr5dcdBd@PNGеuiYEA]\*!rxNrYEU<5׷vv:N*M;zm>bIj(ocf޺81jPtITB@%<;qƆV٦aUW\AB-#\ڠ+^nokqO};-o<.H!!* PEDDSkf"8Qi)% nx<,]eahQ?EN]>]por/J/illoGG/O:ӫ4;1fi Ѡ^ }ݎ@-xepup=U};䫻֨SG|$ 2 hdɓ# 0 &d  &FaM L4ɣA=%4@d&&0OLCL# ~H OI?R2?AF6MLb{T٩2mOSzz&i""!42ODz==OSOSzOʇh1==&AH4F@P mAhC@ =RDh򘘤=4z=$ɠzh@ 4h h II4LI0FSb5M4`FMFF4ƌCM&4*~ɀ4&4=&i1@a4҂$bIG64)z=SMG MzFM6M@xGCd4=OI mA h FSPg+pwiB:u'Aтcivl1&w%&X+7=ȭ5IS}Ssܒq퇱Oܾ7^aBV" ƅs'O_>yI mh>r?6aupnCg {1ho<rwg!7I &4%QJQjbT"CK-4eʙf櫫~ q4U Eq주WߎéTCI nV~wT,e4l/ ::DE=\t$cIchRķȎ}b7$*ayj3Q0$h48>BJ=wrNҾx6ӥlS:gm8(iP(ˆ$]U3[[.-{8e I2MwfN&G U}uIZ噓 z&1e<&e%{0J#ڥh@EM$_Vl cQx&<]2d}_ZRE(hi5ڞ2hJ̼YffoC@Yp@B9u5SId 6Z' .>ɇ]uuUYi$+$C 3fZ{`GLX0`!p)%UuŲg ܀b!'vN$ ]d;;`~b7pwIÀB:|dwrh Cw{~)RTMf(n:訤[ϢJڌF`ʤHO_$1`$6HI&H~"p!kCKCcn͔%M=NIWޢQ?4A=Qy0Æ5̭4%UyO*ٽ嵓*8 ̚F)3B*d289X-VJM뤌[! N*Xm 1HPIOEtv׳<$k2X"!I)DI{Zp:{U~ݾ 2-wɀ3{zO1d`YVh*j@& )Z4) ; o  %p9 F &&V/("VP4`K"Pv2L(t7Bo\n L<X-UT"ufd6(p`+׈lA{ӧ=/>>tD=yb@݌qEX_8a#{&`5O{l/nG LTE$ py;$Ӑ﻽弤$3/ۆF!*.;MJpGI~#%__8i+߇?'o\2{qf$ &Y,9'sVږ0ܝL~;`pEq:i}0yOK㣟;_6NN<N8&&CmyC;׸Q1Xz*g+Irt>jA{'e;۲$K!rWJjELJ $'Vm+wbCn_N..$x[#>-` @,y)vɽQ7{0qf6 9tF4تu'G#Ի} _zuw=b2/-FM,bzwgLI7UrpBtqwa7X9[JB-W%M<0D;ƗޮڲZkՎvLZrc $3%r$ Z3\s^y(!y Ҁ_0b58ն8#u;# !ػ FҜej] H˻:ı)ݥemx7)gAdCyb*t]"{]MM3?r̞n$ƦÄ .qXԳasP+jTե]Bf@ sN##@i1Ki C!6lHi5veDh!PҢBPDhSYjvUˬlY4cvֵ6(dLU^. @ Lj* +smZVm5k&1i6QkX1,sGR<\ 5&ɀoaQ P ݛly0TP5*+HDN(d 3 dFSᕁ1z*AI;u*mZE)~I=⹧eϧ: q8BU]k}[z AѰ“ JP(Dlq7MT$4 4TdURJ2B`+00L Ē@"0  2ԅ,"B@"JJRLFREBI&f +Ww^GC:;X)گ1u_ 2Ф9a۱kmqMmY.NNN"=7ʥg 8MVj(._zyay.$.5DqL9:ՇV TJFM(9=긾$b Ommy\Ɩ5I:1Q n$E;#`wu!\|&=pš{Tvx*e  B֌iR~' e c" dV؄.tY^~^N JJWLjniVLԫJw03 ٷW,ȑJ9JITJQÏ ]$NH5ZPڸ i%I2iIizM"I:ƇG<.DS8#4=5ؓ˚|xPǣ!!EaI#,-7fw (4Ny,b CXЌFj@Ck_cǰtp3gDR^8@s#Bzqd-iVT*"c[PD8JI6@Qᖻ]Q~㤈Qu 'Z@u9Iͺi2kBjJi)Xpz8i֜2g iGÏ3KVS52 =p{n)>4mto_c[.²ó+>FPBP%Ow0(v$hb@)-jZc[FiVD7bdp]@\JMTji6FUړEԑmBr454 qov\2@DQZVmp0*BDA @:2F)49%"=fm]-M"E x1` A| F!1P]$!b R!HC 0)$X%%1Ɛ p;fFl(f!cAC; 7J J B$ H&MI Z*(w^KŖ]B 4E$" SKKE. *:ǡmj$ZN^ݹb1k[7ChŝՋcSxoWhkPS"VZ^ZQ\յU^6R5F`DC19NtOyO~- 0o}պ_GA: z Kt\#)}- 9)vyH }B$XЭ4-șЙKOnS5# 7l_}Z?O W@RIFHy=-?\ʽ^@["!T!!}oڒh+%)},abتfkXח)핧[y 0-5 7A7| ԐdEڦժ,XB#K]WǼ5KG߷r c  Eli(YiH9ixLjC 2TT߸)ꌌywCo Ƽ@=j*:"}reҬɒcd^b $ڂ)acd4#]%|\h3Z&5vDN**m+ D8L!(tQgfDsTA&*K߾[)-$£kg7 1&q |wkvLP1$>ˆM!td5C:o$ /mxL;đ&afgQ@(zIV'LLvr-6{%WR@;*)"7;yC<]nN7z4,*B3"% b8:Q>37\LQ$Y ]@Omim2*2Q{f0>4kgu.ZorXX"[s7ؾbg%BZ Ai[4y3yIt ܭ2%1;3:3ye|5$W=#l\죝NE ݚI* n>vJPNJ7 Yˍ&ni`?L~ I B }&:0BM-#bJ̣ şCtWE+;r׬"_8jwo%wۭx6 Dl4*c$_l"7[}y{cVjS%~"G0{% 0㭳9銓"Ri,̑`*-Dh؁/l oWO8'VG;jC"A,zX[^\]D'uG>D$:1y LjޗWw{>\|>BlBM6&H|j`rDBWL@O19W݅tEEƚ0H|hM=I#{$ <84v c wDMPPd!E(f(QJAdM (A1 >M %TUm~K}1}g.#k#JAޛvq&v`B>rlC4e"4E&6Z5H Xo~1{[joe vK5tk%~\*x.JdanhvuQra<>"GoG f%&sni5pi[XtHHKAю}ףfq ʌ!NB ޢ 'v>~SU ҶyCO_:S3DID&@7O -KnBΑ!By:f QYA@@QnD*DwYmgD0]6v P7wax[@02.dݫY]&o:E3/Gw`k ñ8@8L惴:籌A"ßqACMD~kc^1(}N^EG aO*HU̝h) 3?9((bg(sBqMxY4SkgBL( Gq^#s1ɇ \I'Yտ?'@?7 b${}eCK zTwph9(VTGYtw4+NT9hM^y%>jy8f*(rnfk\!O8gL<9;XPwM}VC@-si3ΰqKbBF՛ƛYK!.$W ;I:vMCNWb_SfQr6,{ܺF8^bWXQ3}j}8xCp".vG=I(!"@$Jd#[a.BhopHSl|JX&tZ\VhH88FOrhqmy@Rʴ`a E,mbzu`ݴ< T5k]k+x:sp޵)1WD&W ̍HH]y[ノ)nh7o%/,kI"30%5  TdV &3u1 uI="Gȭ Ъ6p3K{ۃBtn\ nAX\U$eX&*;6z֕3u=*$"[?rV-!xezav= t g]VU*Z5wWJ Pj,yQ+:SzM3.ٍk̅$Jآg$dh֙Jʝ<&æqo 3J3BDVM bE.Lw5$UNgb99Ww YY:U"nC˧&;9„̧Dnd#qVzQd zE 8#B[ZX-wOCMS}BUw3Y+PaFꆉg[D!Ν҃ALT +&e<Xsn*A嗏]9I]4BX "1g,m,c< 0 Y^!Ʉ bc %K41 g}%abJpz2R>X>b{̢[ Ra1ʢb&,im$ML%ZJʽz iXHM![BLNHa)F7 DkUQ P瓷#Ir5%Bmgb9@lk ''r7tCFR8ɅX:Mᓱ|mRЉ&;glg7ۣ! rf$қmRٌYBMM2cv{|gz4 I+Li&( ! &.V _R.E\ =0Je1O P)A:p2l*R39P*j5wNW vV04 &8X2R0($D\L$U%$*%luu᝻sV)*E@KKFDih&Qj&A9QǾ*l]e5 Tٚem#X&WA2gAkºdVTTAhbZbA:0ab0fҶ4cLf8X‰%bBipī j&`,N{*+$EDS-R@*Q׆ c8b !`<$UJT@ ET@ +` k@ .Nj0p'xk2o_4qa#6dE<(;~?=U9B &PMH @"1 RRTMTၠN$CRJ0TL!Q& xSpIRAHP!H c kTkDmTmQZ5FԚDc)C!uJ*  :p-,vg`lՕc7)ZWX]̞vUUz "@  CB.E &G TiP)Euz Dh@P #@@"x8sy3.[CmZo2}\tPթq:zkҤ@ BBè(-EwAU!Q!Pr"D_dèO=3WډJvurؖ =8꼂ֳPv!G@vE H!\C%i"L6@ԉ Hˆ@.M.Ģd47w%zCĐ_sٗv%[YǞF3rM 9\WǞPx !" + LH*HJB8.@4D9)PxRD ^>wRFwZWIJ'mX棉Ew Kӌ%dC6kW5tjۥUmQ*[RE@p IL H4GV>qAhU =BPppNa|5pao&Di^ڪwכs_1n`c :5d'݇t%s$32,AiF,xonbc 2K : p\1^:D*"#;5wynѳ1Q%TRDiN2 \ΧK+]_S㶽ghZޣ̦VJZ-ody+}Km]ڿ"@DP> R'&Ql_ ^&E48Ԏ"' Tx:$# Yxnf4׾05B( ֣fAijrQ TTEN+(3}TVp E=wzwF!sk[y2,/;]F+ĆAAm^^vXl(("P`&٠[+rPb.˜7wb2٭l&f5k33VLKfNOd*}d*4T/ DU_mHbahAXf`$`!2d-֊ًEmA5)c|EST l +JAёP`wHkF7r@H'\@P(Ȉ@s( Sm"BLAGD(L4!A|gPªRUrde$1%Dd1b4" 1AL("fh̦(bm$1I I% DlTh5},Xآ6B"6HռUqNMbQ֯~ bQXc%ci(*&EUbm cE""+.5F ̣h,ҨRF(5`-H)6*-TVFEXؤ c&(r9aBj F2Z@Qe6R6شU%I$QhbdѭEE-U[A3(S0Ojߘ|ս2U8BT\fJ#(0h5F6UkU-m EWR9!K)pFiJ mi0Ff"IL ̢'Ulo_Zvw7vGSTh * om5$JD'ժT""?(!L\ uk6Ȕ}-IdžqF{y뿶ֵm ! ](dD:@$n {wPjn&VC`%YL$$!LRpS)kZZJ)i˲!  !)00J&*D01+! NBbAd  iF(^ @o $PT J aqqE¢yUMHH"u(@DQ=+>TE? >4 @*䪀NWC2u*  E;Jd=XB'RqȈz(PH`Sf|xEzf! eHB"f B&EJ(&P!dOąSaSf, C_PТv Ҙ)+撽ߕEwc0C:33Hlr1@;t|?Ӛw'ʉ_ۍ 1w:\go6UW4'T?|3a_9T)CBց)΃}f$P}}H?eGڞXO=Q8X>tV=9 N'ҧM~!b?$?bbyDO#3~oB `/xbz`CݒB!= 풿@ЄzPIII"vE'N@9*xNG!;Y(! D*:*bIR' eO9Ҋ% D;W֒I ?DHWא@!ؒdH$OhBsQd AA$?@}q)!E#G Op@%MЃ ( BSX#⬢@$*!0TăV+QA LlI(RhcXhD,LB0M1!D&J,ъ*biF&=gj?}Ϻ> FpqlpA5$mfo>L3=/AuۊԡCyOohxouۖTS DRSpR" O]z͗x`*PA1WR2)*hVPG盛RU E4YǤƙM%T̪*U :mXM2ץۯ:p'(ּk])ݢnm5kbPfdFb+%c% FLTMVڶjUP ~:NAEUBPWnXWwN# [>p6-6i$&ɴlcP9Ht>- C;1С(j` P&4 J@Ь!*T8D, I  6P 0`He4R*($ $ ,Ҙg8LӗOm>[5p\5͑ "!F3ts0f5OQlZLBe4ĤJ]GzZ"A @bbFض Q ̔ $(Z1lYjJ&mQ@M;EEF5j*شk Tl*4 d"Ё2#T.; r f(&H -$ !EA(vѱ\t#eY!B) mkUuSmˑRbB oJ*6Y6ԓ)oh*&R+2!QAZ)fV]֫t,VE0v&D"JAI$"l嫷mȯ]۔&VxV4lFKfxKFiJjZ[+jIxuE6سPrD%mְʊcƪ-䫞+wv"Gh +ң6RԍTְ\2$qեd! ɑtDҥ`R5  # 2đQ]r]7ZFVVa ##(PDrI75!MT[6f6$$LKBP5uS~?~6*5Dk؜-px|~A[d1_I? dw<};*J( jgdɌ4F((( (">9xzݞugǓ;3 " e|qDl%QQT5Du;{gsw)w|m&Ba$ݍޗ&~7' ma2en%yriɞ !v\! IG"i 6ϵחe[N|x}>/Y CUo"_MJfeuJS9LZD|ҁwDq vջKiv»Y.ɘaNd!cB8 OgGov;}ͻzޯ~IJUBx>'OěHH1AC(S$Uײ"<n5'4"qMDh"~^̈́6 BĂ\wn|~?՚ªL3;&u+O@ǷITzg>V/aH3dV09>:zǿ*(PhATVTUw]ȊRUK_п|w78p@b[3Z(Z-Z-űU%Y,ׂlkF 1lVLkTZIjƣM%hieR!JPhB eUvG (#`X4P4k0^yƟ߀U`#v}ks J h4N6 cTNUK)i@ZM%\F`deIV"*],7Wdm*]oXk k)û%MEم+D'Έ^f T ZcU7@ijK \=Q ol,tnrvzt ĺv{[[BV'7qN' IZ&x8I]7鷞u¹mԩ.j]܁ lr=uNQ_ r0ߖmNLrQԢw@ ;S'%TQ{%T%QCS!Py/y6oDMtf!b@*`jb̔fI4H Ķ(03V)M4T10y:>%!$` sh;TmL&̌q 2]]^-=T9j1T3!:N3;˾Uf%zH:S R]ي!RcBND ϡgj04MT.&=hR^{y}:B1P]!1tc | V`g|$*BXNk]nKX [])kRUU$IcV-k:nI$EQh5mה="P0|LD@%Qʪe^3G%6,Fj-{jǮ7Ӿo.Xfn`n@vˋ^>ǽ4쬈*%PA {ĉ|0<Ԫz>#/&8a24- A$֤릣nn[b6kM*kZ[֦8ZᲝЅ$뵂`$Ф;UGd 4 bjCJkH8P*e%Pt*dJ248&A`k0X0fRf5HX`0(vΓL0O9hxkKb(g7-fHJD0G84dJn)m1o`nY* pJ`<ɉeX:e[Eۗ5rB46b@dbO牺`LT7mDMhT^~2G~fMvS~ϕ=Gp7 弉 @Ko#c3n $dh3svL)Dw?AvG=a #&c u?&"1GfaQ?ySթp@T܊Y=JsiZEM@]d]r C6|)Pr@xhU@*F$jɰH6*ƍjT #B*"@x@*m J% R +B ")BPBBH R&0$ڢ4B /Nd{IKl$3xqA_숄*xޯ `Fh 3>ETn]1@ۇZJ7|Cr&@{?XQDh:/ێo@ bӷvTx»ꄮ@D`92I ;IYqO!g=3 s> pKlrGѦM$13w˵! =Cu:!!B6ACe`ͼ|`>K*ˑ'fQE7δ$$7!#jٌxo!{ahC ތ2fTsC# !@P5&ۼpJ}đ?CjCkÓDՌЎ,5}m }32#셡쏖9$u w@†OB (6AdUPA,ζ݆JFVc>d#Q16l0JQRMH.SڊM׫h-i4`dL)3 iEȘ+DNWKÈ8E90-* DJP.ok iiǨ}n,+w=jI2!6-Y3je.tWoxxʺǍ B94\ik_@?`>"od Q~ܡq ohM SD\uUr*D `]}He^:!D8.0O]p@+a X0B €j @mqO `玖"AX̤ca.dMgH2()A]ęXÊtz灄i4!S0n(6XD'CyAp*9tlRaՒ9K¾>TFZk|o===hr1RP3ZမZ됯OC6XspM N_N}CNV Q-J_[Wp2EP=Fidve(7EPI;IF!pšoIڔ "rEl?ћ!tryg)6L20a0`@ vH5jxXihsO qcb:x75T6 02 fDD"aL ^RVb%ajԵ3,O7n%Z1"Lj@"v6ʶ a˺m(,D3NTRUaq>ˡSe弭B#G^Xϒ2{1~-Iv<939G<9WK7I4Q*zo> ~ RIk+u:20rل55O'.HL~ Y;iQtIg~o Uon7~g]/Jha3V~D"=K穂M`5_́ SRP%Ġ  @y^ i_߼›χceOZOK?]$*UV7ʘvo󵸇b]y/`xį5y$ D۰H))W[\燲-ld@fr`0>c~-ýo}w=fOd|AFMBx~'<דĀ^ Z|8||wAp=?w?+'X Ȍ FdG 4\~b E˾0 pHA./6E*ok?-WYIJKX`S,3 %x%e͛QBvX %&$XEyy^K|EY2gMĒӲauLj*mZ2{l,+}rcʎ_[-;ĢUuWv꥚ZuU KJt)kאmVb!@2 &"˛^+f3 6tv[xX\sfcE D$9p7* |>ioĩg#~قtdDD@n6{>*NOKKWk>EZq܂'fO  l`zsn -@0IzEyg7Yv;blΤ""d@b AB!BG͞7WkC^b>}-};/A! bD]0QW^}4?~BLJ"M$lТ@]zM _==B[W QE{h I@b2JJ(I$:{2\\I*O$ g<[ޮ5"|eE""R|o/iYvt*ݦ[\}g{n_7׏w].-Ė5DOV;-oynzbdK:9B,킪_ %6{K״)IWa!/9ĦЏ*NΎu֌˚sý˼7ޭGn6k\|u E)äHUZUbo2r\ Gd]zyڞ=ϯBfJfY4Ů i=^Ϳ%^$Q/&}fIovci%l@5޵ޫ{i+n ^s/7q!Ֆ5̢;B%+g5-hҘ\"Fs(?_cbq{-+sMŖ-xZFjĚQ$X媓QIyz]˙c[Yx.ʃ x![m\e/LJo+yfE:id0 5079OwFjNd@$ Du ]'W,܁TdD 8w刈Ҳ^ܺ -T rdU3332>?1114ՠ {җG_3ggrQ`bDc2 ".S{$ye}?_ϵn0Y ᙀD[ 3DXWl Z~mv "C;g$o@{( A4t`BF M><01fOG^-] 0^1x $QYFiG>9P}L!ۀ!ID*rT*!ZMO~97Ù8uos*yӑ2\_G@ BH%EcQt2_i)zvut^%v*bAjE'߳vuKS4`&5q?⫛&9F~s.{S9yjm,svvϣwHo $7/ͧqkpӃS@,|'+ɱyۥmd@xDS8mv? *nhvsW-4#5Bh5H!("6>od& RJGGM{wW`꒩I02^UhQYԺۯ:eXt i.컜;k%r1r/Ud"`j7>79=boacfqxV؃I6o[eX,`28^!7~^޸~_iL<30 0 %^N{~q:9t:7y@= f@m6#Ih&Mt=fA|q_ @PU~#?QP}N~o/XS9-/a=ka(R @(~Zab&lP` Ãynj(!3~#}I#NOއIǾת Gu E a)4aM /g $Ѓ0Cy_W_:mjţ/!؂{55@T@vOP?03]Ip`  ǁ_$!a#A!I|A2@+0׃,(zp ?qNS:(Xn/Kܨ:`; =\Q6!ｸI8}= +y $f2>  }_Ӵim/{ҥ=zw u^)jy8-rѡ@" bRotPX _S2aWngϟ 0DpE;j{fAg~6D?1Ӳ2tf?k_mzټo_-4rde6Ն2)!s @Fl7N&ᶘj`&}x)[i'UլzlF*:@Lu.߸mskv}N:^\>C47ĸf`@$d 0@DJv!uzz׏7`Ѡl7&ϛmEb7HY<9Նi㍯gɟwZE}GU`w]/wOOflmBLorM$xOpy߱?'3拑^zݷJ`\xԖ凜oLr"f)~6ar`h0"suTޟ@;td} jr5s]M!ծ83p\ Gx]dk|ڌ[ÅㄎqZA| HS¢f(qkt?|NfѳƗ,lϙow~֓7@>|U_jre|zek&=Ndes^sj\d<YvusaQ}i;߿y-'}t"r?Aݑ;MK U,'%ޢs' ##5u @A;\M[&)W<C5/~OZY9]/䵙D#OO3>ș:}}(;VGT"B0DPjd~c J5ZU!@o z:L#qk;K'y5t ׽u~yWUK+YLjU֬{*ʡݓ?W"mMo̡n4ù ˏkuȲBRQ-y12;/exks4جoٿ)[Oo*߃ɒjyEyKwoOINz2>"}'z891>o\=>OM0 {u[ӵg];<Հ4:1a?ħ|Kũ-5ƽFF]xJl`ʕ}b)o7.}F_&ce/-c_(Me7 rwYM)mؽ17q;c1[#W5O1 Îx͐|m4\g6:%ӴrJ&'o1sdD\3ȉS_}#L&;pnگMƢ~55h@\c٪]3 #aDm/f 2SUe+4%{4)J)YfNv|fEΜ$"HQW л +Io`@T˥2Z@g.^y~« [?)u3uw5?T~҇Mi΁x+gb~9kJvZ%)h;^'}EyHT.5~s!Xf/مCc{(DkT^yuMW/o(kJ$*̀ c-aStIPd"  $ko;rt%2"ٲnqneAQ}oka߿qYq'Y+YHRHdhUwE>7sU6`I+o,ČU_hSw׆2# ~ %[i?NYul?L8U'YRƦX* wQOorz9+d+*m-~gQ2yD_$qĭcv,>-9 ' pdGm9tpzPepoofT:_4O_ZǧȭMek.a*0YU٥qٍlut]5%~`1y/<:3wytQ,lLM| zO[Oą瞰zz뉑Mɗ""V N0bmbOjVx3voWLOmi{ J#/JF0^uS s&2ya9[/cR3fͿ<+;wq ьn?O=+n :S#0 ̀3,gum~x\c&VǗ"wŻ~-7ݥ_ Ѳ`;2]UC D&|CE4Aj%n͑aSK?j_xsPf@GE3\dWHmQP? .FUR8R-<7OĚpNoq79@J,ݣDòEQK_i+&n)<[`'{(^ͰZu?Kcy3C8\|հf9)Z-z`yƽ_Z`ʿzGIe6\<=ͮWqV_=ll ^]mZ;UԦJFڱiAyg_iު;2EdɼUz7eZh{^#۶!-3s8,?*v8x/+mRg=7 >|Kbgdu&܅M"q<7Yb <.=[]SRIn}mھ4v9a $` BMDy Hi >7Y5I~ΒJ7.L08*`Sp۾;9/T?( aA࿠ Ua)qɺ '^F3<)_Co|= d֍@THCn|=8%.֋4I&,iB\T<E#Iw\&3\IADL Ku/]vh- $.Y4˻X3Q(ٞ邙dsƜأILMIJ2"oW\j嶣TE-5Rsm34ҋv=x9?8v?ѷN//~s b XlRaB_t&Ϝ jIfj(IZ"ߝ*fm ZJaD.sR @6 aL#4,EfC,e,X)#baL L&adHPi&oՒJe 2"ɱ o{1UJ mjlj*l!M/߁_ z,QJZ#RdeI]lX(b-I V4ЌFf3QJFLI&aa2(I6@"Y45fQdL4VLfi-31FjJc"J[j5IjZIB)diX66d+jv)F#QXlSZL6Rԝ"dUQ7׀ˆDN q0H;H½ 4RK ):̓J77/>1d2Kx6q0N_h=uEC(3",@\E9K8T& 5 )&df Ɖ~18Gt3ar>ǢaUCj iF,1cmd~%** -κO ھoe6{YܣS&}t?8ǤD켧l 9p5rUy3V<{~ ߘByiCaaN CBo߅sZ[cY52 Zu024!Pg`3˖+}Or~OMI//|7y۷һ[Lљ@@$tq>Φ[O1|O3< },G=&Ea/G~yާqz;O?l__Ӡ+apgt8``KyУs3xFPFXinInϱI*6*(;{(mMq81GdHA"x[ﷵUz7OA$#"v'ޠ0-0̙͘3쵞O9l[?ac=Q]>W ZwH a^ LDq''DyD&d0bHJƴ}GǏ97531$?/$t @@ rRzx|tM/K;?TDQK]CGu#ש5h5.bnǛw3]P~5o&2^A W3m B3q5QE@~Q>2+^£!4!3OFtvhw>vSu9#Ĩ`!RZ4fbdRLA-mKcZVumINQKq/dD_#`2 k>T=<4 1jFd!ӥ]jo .+!ӫCgO.Hwʯݢ$mᅓ"VC.Kf$X}b=RofSp^q{7]lgT]䋎 A\jC?$> !D?O(3X76AcRE S`e De^ О'Y[ʤ@#G>rS# S,ds?Zd#' ^_[RjM@R#ACH琕M;Ixא?)[D4ȿH^2>@'?4tsvLu4&)dg3ʪI VE>\Lb8XbaI *yD5 $dqSb~̻@%89W*xed cG1.Gߘaqt:I ݇B)KLL)02KcCqz\Bp}D0}gT/SiOkA<64yB0Qu~_H: bCv&1!E86&h El8Bo#d lLgN_sg2>;[|КH3݁ͤEcX[{uww3TAf%AZ56X ߜxBDHD'k{bzna )u^uʒDlF2 M 4K}#kU!zTDJ#^|tB@Hc,B{ݼ5I,(f *6gQe4ɲkEѕ60){ܯ֕ͭc2ҖE- %Ԍ4#T5H HSIdlᕢ4 rLVnlJ~};=8ŲU U $ NFXdzlE )54d2ۭy߻Nhguvj+YbbVMF!ih:{ີ׆"SW>}à)|0w(lP<'dq7$Q`C D06 r4Ȕ('0G}ySS=$:yT'zG6#ӈdL&ǧ>Ɛv!l=X(j֌Ӛ A3Ө (iٱY<DZy]|凉z$0{ 2 Al`חo{#r\!J.W0 (ƈkAF!w 7O|sVXvGr7CF_̇G}x7m[@.}b+<>'CO &|@f>yh >{u3k!%X/H BfGT~ M |m}=WH}@S3bٖyqcETvʒ4#1+m5d2-Z͞;loVۇ LLnU jm1ym& dW^wj#IӳӾjMI$:M :INu7MHDhFnDTG`&ӺcL2aaRiFRE!!Vh, 1K62ljj(bD-aY"^2`),I/iJYoڽonk(EKFE/)+7Tb%Ϋ"L0^Yj5EaoJ6Q4RFьɣb dDy.Bf,fP1"(͆˶ٛ@EL-eX,ElaXHŭ)3 Mjf[Sb).gz ӎVfc)Y)yvJm 7v(Xkm  1^ׯgP345H&%2Mhh(PE™(ew[@C73SV1i)66ꤙ0HJKί%$sѩ  E

Kl |!8f*i: .HA L^AzzgcRf$ A vo2(I~:pTZ2Z_5̲VcҾ QKMmEi$byO6W(X_g͇f`)PI2JKEyM0b$Ͷii%ߚ?xX=V娱"$oU_$ BDc_7o|3Ȓ(JN]>JH(v; _O aF)ȷ6rP0A$yQ ј5E00ai[` CTv|te:(L!:%JqIQX10ʹY ZMpR!*. iIB I&q A&Dq!"7{t~h5kL S&lYBwz*nr̠2f`OYo(#U[4I''Q]6Cm&(j$$Yl#mXbD00ai[d..~o`/jDEӴbgR`m$i,V[E3hmcc\ܦzk Ka!^!$͡caE1&g%v FUgq̘! {W3meZ!d#aFMg|Dtp%$X$:cytHuM-:$60I!޿AwٛPP넡xQ TqT:E &"jT4`kfeE,ECup @xpH(#mjUٛn#@jb5 4MLY0#eTfզ""j3meZ!!I5  g$YvyJΥvAaFȡi!% `f\2J`1=u;[%jOOdسqMfPEFę<<.  ϛ u 7,M ӻHݤVF]{% 9ȎޒT(YW욤 r= aT$hBHʹ۽-l_7Mݎo97Ñ;>nAyvHqG ]$Rx')Hɣ" T0St}.m.!(~|p_n!.Q+BiKRʉs%ɻqc>l=rOQf9 d`M;Hb[_ D5Q.\X"ZK-\ɫ(K$4);D9^"̃p,/ $ f q|H8m#(y0Alf/&5B%  Q(=I(R{)7O/*~ 8*G e_%nJνrsˢiNQ-܋Ô=`@d ji1E$(lh&4aφap㩷Q'.fTNxV]Q@2lj5Hl;`yZ!Afwp`30f 9M"UpɱgE#b b~?kd(HX637ݵ$Н!<r']PC&zy11(H*D "rPrC㥢V5Co/Θ_Og$NcONfZTP&ڳR2RRhя&ɬ& J8+vX{m.>Xu('!0|~0-H7<8!Uy:M'"b걼Ъ@1B?]6dA 1:RZ XQj[#(TX [/+ ye'.7A&I`h}ZT 19)pɈ,BCn?$]ī/vo&yO3y B%[ɄNFJ-;!5QN!bU[&jG0b)u ٫WC̛mpaaf%}zp۠0CȚ; ¼P-dT> 軏$ 2(_~} v 0=>n)޵S2QLC_EՍt03a1>7foklZ,Dư` 1]5b }k-lbx,"kA%U ReŗڇA9a(O\H{lj;g>kbC䱛(:y~Ȏ/a5myRW%toi3`0&ן"9-񘾕vRĂH9lوsO5*iEF56Da""`g`!D&C0’Pcbxa{|edSO!;y&=cO%OOAD`0Ñr.1)MXDȄ,'=ױ x\\(;16Wǡ4 kRMM/0Vwf=M <@.l(,2"w/pnŶo,.b1rSaҬAbݪ2Я NR's:>%\7gFw}&%`Lr -ҶX()G -ZdmX5Y1ذyސhLzL G {$qӗ*{:!z)p g:c_~whd~o68}IQ%'Y.˻[jEi^1)~JX As >/,?`ˉlgh32h5Bqݗ/Mv#/}?(&1 ӽ<`08H[$:?냺ݻa(Cw;SHSDi] 1QC]C_Xh5BΗAѻW`8c'b,CMغt"Ed4Fn w U%@7].ITRR5Q+$U 2̈r,˺(tUMc2 r UldŴ,̈!:v{WS9YLI|$TӖ4QN'شr g1~IԒei:B#\@uH" 2˳qJvJ0`h{) lE;&}` jvw):\.g] M #m)vK ~U4H7mDK׋c.06x+r9U;5rʼvA$J v4?xyLj -vXa\y4v!nGgiw5kR5ʊ!FiY+$R w.4r׊5WRI]RpOdבtixp^ ֌U O;aXaf=*u֤K?y|r8Zkdu27G&G8' tmvJ;UZ ri ПO`.9ʀjENn-qxb[fz2ͩhb矬qʻW0ң+N*+dǢSm}A6=tf3nZSOǯ}0Ծ E"΁!YTo"Eu݈?vIޯ=YH F_ǀ`<1 vgydPgw#;Վ,!ioqʻc+}-s{$kÏ=oϿQl~t}I3VDAk~}3|N,7uv_E8g5CߵBY,WlS"Ż_!B{_CE^r4rO2>9s|ehis@˜T Bd9#m;F Yw]|tэ{*et<|O?1uiF{[KvJeS-1Ѳ[ek3ݦo'r*m~_{{g`Bg31AҚ$˼G @Bf]4nO =($,0P$P&^+41l%ڒ ɡ"@&ڥ4UK_x"nϾT;zS 0C$StOƟ nVd?&nvXK f@ i³7RF:3 &iab }$h /•LXra~@~\{(|g^Pn=ύ rr`|Laх~߀?]*i5nK\IA.7,&<%A 0f  Il%x}? t*,齪v(STa=FI~r9L>& 7khe&LsLoC1^?6ӳ @fGQG7 $d}~j6֣Jt[ڼձbƹUڈڤ*-x桡L.F$^!RfLlx^ׇXE\^Ϥ*llf|x$u1Ǔ/q&a 9C<c{/tf@ )ޭUTv5/^;7C|7E4HzS$/;{i#& a,lت Cw`y?0u؞;EG;y~XhPp=xbp#`p \H~J/mA@#:?GzanA|4Q> &F-T3 H;^1lBzARDva WȊ{.OuMf8)" Y-@v#sސh7v[?lW~܄?4j8 xjmguؼ~}A/(O3$鏚/~%Dq0@> }U(HhtQК|I ҠgWCvƟۺb[p~@A8: \ad_[2--_RˆۨNLE/XAdg'Ƶ7k Ds7t$dMQ\p7 }21oʮ& Xrc4@hBBNC1G is64YKik"Y&4zn[WJvK6,YŖoE*1E|eyRif)n|]Ww/^[g sJrQDT?Q*Pu}ZTI0oɠ^%iIjd40.6js5$iXg 5j"D5kk$20I!(?U~Ri !4ґOY2G4Wֽf]ؗ c3Z|9yNI& Nm%_;gw"]_>PyQ#Ch`HB d6҈tƀ\qC@pIe@7 5gF4#b@7 5Ǹwhq /ga%)4 %cZ 7Ncݼ@m͞͸o' )n0v11sOļ ]=&8<f@O^!Y=?Oci?_YC !z2WѯW(tD+ ݃w' |cw-GM>4DLh0a5c1&>p 'i%5 d QGa| Y ͼ$ Z;G+tB*U;u>WA~^BQ=%/?z}{~X2`ry(b&CwddV (᭲`DY ^3L$2mBa.4UMT_̤D #zos.#͹Z̫H^:4ZSy.zy{ms%+^ӡvwe}ws׵9gWӐ sl^-pGY:6\:fgy8r/K޻Si[vo߇*G''mnG6&*tXz+~.9sL_gN[rځʲ亥o2=D s"4Il4)# aU@vjNQ6 Py2k^|ghPN?OU2w4Ё.CD$d&2n-WU&Np3!&C=N J7Z{wyxDjoU:i_X1xU%q`ὪLSif+S TGvU 41i &Oͩ }bC!Zb%xبֲh a ;%9E.WG.A?CIE]f= ;l!3@j&¬OJ_6lưrjPc!峭A[Vwgs7L08e5cd]+Or\6l8o A$>@*C%]ÃA%v`ѻ_ZgT%h%-SIäWi_Z3ZѬ+䊰b'pKivpU M> `gQ_4J}3AU+v;rg!#%ʔ;AH=' ;al;4=0M >NjSHHsYtSP2 =0"D^/g_̓`$k2v2(k1n۷h]$!%=;,3tL z7yo/AobPˆ ;/vH0 uGDwmpx):.7aqb6Tn 5vc`O @z_'?_zbȐ'^19]aF'{ݯA<`Vpg+Io=饭5/ִ;Usa;偻WY j~,05A[]NLb((56\'=Z^8h_RlVQQ0$`Y/?M7g1gOj`n=1Sہ$3{{uf=@$UE``$|pI fN}h5m9HJ( ]i3Βģ C)[5 Ľ &  JX0fD|_oe"bZ$`S-g/]fp voo%{WT2Kg<8չjl!0Y`'!o^8\**̙ rS 7\3_=gE^`(2=r+v;uiD> jUmi1U:v!6DJcm}!h}U!Xx}_%2-6X:?1Q[eztjv^Hڤ%${Wݧ}/ 4r}*zV3kYϻH`|#x%!Gn_]TEcv;jdsW@6)B4קVʠ' Ѩ4G3||D8Ҟ7^ނD]'V7]{$1B5OV(?B14O|j%9J7Pů0l`xGNKiҜ2)7IA"Ū 4db4k~DݎE!xXLT}I')g0b}X.^%,^Yc=@|j~ &4 hs8Vf\lͱJY|?gAZimclm" R1~sA,oW~]&q;\M2̔&Fiq-!s^~{jh.TؘDphRX(vIK4Bjk׫Aةvi ;]C=`vzj)Uo] l8S*>K|,`6|ý :UZ#!@g^ YFIU80@ RHZ>߫ dRGp[8?"_U'}V`, aI ©*M:%%;3cRX! =]Bh6|ѯq7+Հ5_٠unOz{?o/bEk}WE~C~!je~<ܣ8.,}o51.^\s$GxHGa=?Yƞl`7lLS5^UqK.qrs"g%`|;+5 Ď W+R.xpqJUD(#u# d)'׷_WJ̡  G\(vUB +yX'i+UYUZ9Cm< "׍%I 5L|hR( U115zqд< 7X_9wu17 aր6F;|!Nb>\jӘf}Dz9Cdq1D/פiVA#oPMmrҒg<fM^Xc *gH$S. "6 raHCZ(da-*b }3prj[ϭ0MJxz|׃Agݫ6|@S:1/X dIMt6EQJDc>I~\v2 Ema?|F/t) 38ÔX:5q)aj9B8Ztܓ[Y1@|\$稦w-?hLT_9^cqFFw Y'tˎ+_2ѥϡS)t0%UÜ4# shVoenb4,NBE}ޘ2Zl"˽9o0]0~bE0:B>s ;!rRĆBMoYKMK=/OCۑ}F$sWjߞ4K۹WUutiPfoWF-g ks{Kfl.JvIb VL~ %ktFC@6︉1 3޲^aqtt{4A9$Q-Z U1}28p)yx=!8Z6\XuC1}ra~)q- ]c_'~.Olo51f?.Tn[n qg*jJoH./bz@jȲ["KS}*: >KיzL{čW5ɂ0olq.$ONd\Q؄Bn #B[$O!9Jҕ[>Lh9qi@NV_ {z(JF-{<_v?1׀Me[Yv+ 4 {ڿ¿:;֑0._k1rʱ`ej qP,mk))"*N:,V+\%h=N۔3 \ FlE\%/R(E1ص8= ѽ[Ei8tQMz}lJ$/1 v嘽;3L?V]k%|+|J@8^.O g?sG0$I~!~cg^9'[.A~<]uva_~ANň?p#s@O"&ojCs&$]!5 _WT|MCv>jz6゘Q [hMbq\2f 9#>muÒ3׷FнH?%JN4ˀ$OhG&/IkUE*9-Ly5A‰U-E*?O  {7qqS@RD?G 9_{Q(j9oBD1.[0ߺ s;3Q%-zL%>qŸ'>uUd<-3L_.u d1`1p9:1<nPm롓ЮH`+RMufflwBS A*܈~LJ HeOpt5APNB$+]Yx+27@LX[&\bnc%;~l&ހG{7 jwWUX0"p(i:$9ilwkU) ܙDޒHr+F,!j(?}ă(:o*Bֵ߲8y/ IXOYPyڱc&]"O:HkoIyr-6_paӼ,PIvbk\p:E!LKPrxO^C%f?1 FϵZGu/ȄaC:aa*p Yt#P]nXPNFlJ@Q-CK ]iPc52! Zj]++Pu TLũ" ?dkKGN /%X,[NpӲ5}XXWAM>1BiUd'sְ^ss2c9. ZL͈8t!iASf{ w"-o,H-# aʁp"`^ D)F U BP{mZ4652Ӕ_ƴP_r%luxqbE̍{fv oeX>)TZDBDӁI5P"1k!ԳZ~<'Ʋk`";Jj1$XVG@ST>[bl!4Z>l:wAxEňCamG47+!G_G*QԖ q04 _g #>ơЭ%6m \+.D5f)|Rdjc09bC`@}.S"FIaUز7:-]˜cԧ&_|c(p g02} 7 58析I2㿎v y)~vV9\Z˞+,WWIlN$cF_a4OσOr ޮ. >oDey03} LHOرҵrϪwvbX: o/2 Y9;{B%=[ȩX4|T2eκ qAewh[cٴ^A]L)ON@9de?d 5oD2DN#8=kRc8&GgÁοpH7o)Ȉn;X]ӃItw"TtCY ָ"L._ѣ6R higD9&A."i#Xp"H!b龊8a)oJP>ll N~ׄq\^j4)]͜ҥF;% =@D-y3ٸl]-&Fn+\̟i5.1Z0kca{6/``cGLZIӳ?l1=1s15:EX6ã*xTskAN׉ʸ%ϣ%jbyF10\$c7@zFZb>q'sbSl%R+p@yo޽G+"`6 N;?AXgxGzH &yi{l'C6#q }|'m5ZAK(nYym3f mHNmj0[_AVY˟oDp_/_@`Y˧XwV/-eAMSlY:|w/׌#d/tY?a=x}SNg[d6ex3p~c&ؽO3̥z f4t$֔=B9WO>1ھvJTjK5Xʷ .pNQr߻C9?&/Dc~U~>p AҒZ"^W M ͬsbbE[OQgQ>ETOΧtp(S3T//d;Ip 9?L*X$ݠUs!fsa=Ŋ]i"<uu-V"9٥Է@MNrSl,MQ)wQ/OדeA›ehuֵuq2rdzC ɬ x8 ri}| YS6{ݐk횙!&#'4kh wSW2yH>_n% `R]ΤSz.[: Q%!aS)H_("v|ǽ6?RzV%3p\IR`Ĝ o`tdώN EqF $M!s#hT}J\IC")@jt;Ul8CA06KGBƴ/m٧SWJq 5 4a"x_6AٔqI$p؞9,al9e*'A gZQk)gFT-A^^97\?,RXNZ^9 [FnHLب5k# ">w$,?4YV\Ah]3gɲMBAKZ w2.t@0^'0Plf1`:pfv' ЋpcFN4޽Ep${Bo ‘/ύ0phl RlǨvT*T,Z7`c l69 ,]`a&%%Q#Yg6mKt2)GEpgtr>~aگ7_B[Yv^+':(+zL0)˄/CxmĨЛ-#ugR-`ç#[GUF|-rB[I{PPp Y?dG*Ma7]Hw$`py')֡ to (((!~}SlQg!x!l'XI3>}q]"Z`>,P"" w(dSV.,'喸 '(> FgתhNwMc([PFmMV8RL#1BA~iQl O~0T߅"bBvg Pac^;-F(ᛮ[Qb-̻YdOߦnB_,iJASހ ۷ejꕦ_xb;R&U]kz/3_[ Ak2sːz| ס W\@Sd,/<ϵc"Հt5g X:2xUSxy UD0r3s;}!)=n; [n3)Vx~]&;|>#egBz'U<ı%/&T;ҲRSd~qFiy>1a %!H7.unq J/~O$f[ eyY9 ֐wd)Р. HEbsbN"ywuNSii;sl*I5Z95ֆ.ۤ w:8!YDu̜ev~C1,;*m`8b TUD7.twu`/ۊ Clt0{UI`O ++PnċPOSzTexB gēXƙΕFy\{PQ27%@89Ȝ-G_IydX[Aȗ?ʹp]^h&P8-p Pᛞ]Dux55ƍ'"9BB4ؗ7hv { `/%8fzECإX^Q^KT-'Ȭ&enAڝ4¤ǙbT';uSߨLJ25˨_~Vn+<LT+rÞ#h}Д]nB`nTi^.&,@*Jf79E`};>:)Ǐ4::O M0Ϟ+rg2yӞ]&m\0R>d1jc9+s *h= CkZΣ2E\);$MvP  qjb-aŕ҈`&W)7 ($|]k0X*|CS;g՘5,PZB*õmu~QՐ=˺Aͽ "PGDNY-\!_AXTzM8A}A1$܂=z{2Z\!$:o)nQdlZ Fo`ZJD@@0Stc-抚'Ċ 7dk \Qi.׊7^%*q&ܻ!VVOpǁvgu _14ֲJM¹)R]h+ >9'U dG@LIKnqc7J[n0ҹ<6D7+%ʎx xllPMg^y x iBLb!Ѡ2NՐՈsS`އ.cD{Frߘ-)e9A}_1GQu՟B:J,U_'K+V\7Ǐ9g]w!:vz:;H \W6Ieb'd<.p=0?m{ 2GQ9JR#xhM"Y ~\(N/35jS(QKN\npCϯ'I_+&\Zlj SLןcᦨѠ<4K-Qu27>HWtWzmvO[U੤S8\)sUܛXrV9#}(lڛHD2-!F1D)EsY(Id;8-shZTO U&%:OAyx\R咺?ޞ4qNI*)\}jcƊb "CO:re P:An[HOgUPB !{F H(c^,W\<#\_׏1lڵpqP)0|]g$sn(ՖW/Z)搳,c^%覕YjkEi=u4.>2I<GbyIBXq\̫oZߓk:OEL GeoP u0gчJ"T&>~%cϔQ.+U=}6_ۯ i,3%`J6FIN}U`srV)- RiS8 ǶזDLnҥ78[ND uG={-FWڥLotlw}U2lB OЪWr kM2XQp.zHc!{r#ÎakwɃO/ibA)kT5" T"=^ K&i7B f'4JcAh|)˗yXpA˅NE k#T^0MҲFg2>wR|%O t%((;C܀3&^Tb{Dϲú9)R*bh=bS| /Jey]m\+hިͮlKIr,O"8C!G"G R:[gmFC $º-ȨE/߭G[ZXs%%Akd _h@MRY@TNt=DgW.f v_AKWZ$]` Oop<7&>Kw\:MoOE*j0ZDu(Sؓ WF.AW}Gh_OJ7ҁa3kABttL+ỹsr~A"LXX9g MpoFh^H;YG2&?5D2I g 8]s,Z+w ։SJe=I޶lU&dl)hʨOVj]nFt^sOB"YLl4]KLtj+Pw5z|\4 ;;:IvӸ zWo#XZ9x;RJN~#E_Mu.`F& #=Wp)YՎa75(lm&Co5ox}z\hg㲉d_:5sIZ.e_' D䴆WTIARG15-Z!7},!yR̼rxiK x}c"XBzis$TjhVXve¹38䞦A8n_-+ϓ2]v? a]b5rf f4*r qWȐ[nO+Uq~6^ÜY9CwtKztcUZRB :j-6kE5? >X4+)P [L? ;b#cX|Oځrfg*'L钖Cͳ4j5P1w˖~DFUց;GK\&L"c2a\|r')ejc r>˒yO/a <yx_xw#h若=#xNeW;@9]ԅ 0,cׇ4OWTV*hqM,r3áS竱G~Ic7G@Zr0d 4j2 dh.A.P &!P{BN\ D[W'£J0і`~4;x'aNݫw#sX Čb9m~O*AGϧ=yӞE%4oL O @f倶ڡx$$o@ ޏe8(`G#[OT; 8qa qa05 n*"'Vl `U EFog_P˂т:+2OE`8maD mh=Go$;YxeVrV (g#nc1(ĸ:rw]^a{mx);xcX@ڶ 6SݤJa =~2ݛb׺.fl(Pb^٦D՚wyEe7;U"X"|O>QlA0d{y;Vһ7O,xR.žE Q| ELߖla̢ ªUyX.d@z[u^vR `Q4涕>//IÎX,0AV 􎥣ґt9B׋;o Tޡ=R_"i@UQ''ftLwO 減//>T9ײGדu b*k0p˕?ξS#ƹ/* S8#kM5dѣN K"2p,@o~bg` iƢSwТӋg1S?c{JށG=¹Bj$4 +?4fT(ܙ[u<υ|eAJf"m 86"5UC TNlvjfo@k\^GMݱDocqrn(څ$iDQЅw)Dl5{Y '2n -oA`. wS@KHe8g 8 XmBc U 1ph+3SN{N;fy.mTź+SxB~TLEBm?ۊ :3gc+ $b*/9w-ЉcI=g%ol}+ށ5],@H2=ԙHqR䀣7ۥ6)R=`,Ob53b1ў!$ѧBJKDegRLA%lsݼ&&oQ܎7YS&&2MrO*`W@3y:,4<[l˝WQU`YY bh]պj%z.4,GAGxLGș?2 j&iЦF* ƅ.KG*oM>^^FkIo p85屷g(^MNֻP6e)U`!k7fu2B hoC#疡kJ2gi|턠? 仈1]w(U7-L %lͺGnrg nVRgajz$1:5x0&aUaWJgRG2=}H<":a+q+ HQ&͞\+. k{ fl̵薒N't2 a(/iKU-ӋL,\YwP̗dR`2q s"_J/ejLgJ<5)>}~n޾ t@sT9:e6{JHm,wuy\> 2P _LWbɆ}u!@d0G'>#2w=S6o6H>r3:'cd@s1ѐ*0LHP* _в-g*r3KH9e_UF3WpgH}y{B#e ړ"2caո+DY׈fK%[$M9B}JsNDXZtΠ4oQݽFY|\ 7L Qn.c-A?尫Bݦ3[ X hgA[(1ϒI3_dE+JWut' 5*b]78=V|W \NRݬwAfEw/{Gnu/jKqƌe* Ç`,CU R3c F]!IIosp+҉,/"*s ;hs hn6.B{9/ gEVd =w R|CN :Ps1Rw~M%{rf?. ZW{pP{mxB*>=PWS;E 4t{Cn\Gцv"1X4 ?Ŗ~'UL`e?pi i2+}P$84fٳ,xp7- :>B]Xq8Kv;gfk*)'3ТdUJu!m;:TɕatGtb }ȫN }Uvf .~Q{N.~0)?Sy6(sYȄC$$E0 LE]٥Aܴ)<\?=T*& Gޮ VQݫV(@栶M'\+s&ߋ+SF)Pg%Ȝ#T 01*TDw,;5h-M8W'ͽ .,!U.ʂեvHl)eb Ls/+Qqۦ 84,8F@< ?W>l?hP!N}'z7lpR3MY=oGa@5#7t Z hQsAP1̳* 'FDF)r:AtOD JsZDq'hUyGKB*eV2;y5Jy8Ęӷ KHg] H @j^5:Κ.zBe&LumAS N; tFOSh+PyJƁRa&7OP[`d Cվ?lxivB6ۦiWZ<<B˨@9#;xw\f51"~@ESz/Df:=kT>帤)jp孺٬ :>פ懳xv Jn(dھz E}QqХD3dfUYl2y >9hEq7ֹpYkgSL{mJ8:F%UG$uʄ 3p׍ ta k}O,Qz]8+/"-”) ZY7k+׋W%d69g 5C ׂ\_ V [oЕeN 7)H& P蟲Kdꬪ{P 073+0s#X-p?ȓDkj}#7Ո p3G<4F<)Η+^"V;= ? De W8%Ho]d0दP(^R#]=߼4ފP6 y?ѸT59]iqdEЙ*M$Wr?}E8'`#g]PWv&v7?Ntmajd"l>B6zn?,YDrw57<1u47ބTt,Hi HQƧΘ* 'eV 4-x+m`X,r>بj l,Xn1@o(ԛN[$؂WJ?}L[7$zȺ-IwEIwyuJ)?c80&h❖JINBh NR'yֹft *T}hJojDs! /c{n\Y CЮ֮^mkPXUU!KdRy'7)5D3]Zf~qa%asKWy VJ4{hLq |)bI&4mkNF1^nȋ.DK\ձgvj%(wXiF]y5+m{rϾxel[\}bEgf `%M1< S\Pْ~^xQ;h?5efQe| ڈ0&1T̵34cgbm< bU7.xD !q. yĽ' 1Dc39M/;|ںHHެ:){;W~V&XlH)>a9{Bެ 7RRx`&EQCiANq}{&X7-+Ȣ ?F!6#|ݦ,{D׬c[2}>B3 kv[{LA{0oyvfucX:$믉3<ϛ \X="ۻL>=sqYDwe@9F9 xY!a@:^ђڭWzFq uJ~xMaw:q7zIC 9%Mc8T[c;5gU)C #5 ݚ^ *o'jEHvZT ʹn.M X=&,mЌxUR#(%X.D&u`MhL%e9as4DʢCdw 1;%!Sʆگ.}&JU oRfGxuYuc հd tztj0p)8esWM%`MpAx14D~b8M^{IGp~ܰ7FcxE>[Z3O"Z`pg73ŻuՔ, 2QG'WEgY UuVX•Lcw}pl/MԑHܢcOߨA6p!g I: GD~_jǟXcI$}<.(4QBfPټ3+u}g(θh.mg3NA OqFw7Ekܓ7Y+g@` KJ U Br*884&C&~WZ}P7`n+|~!)lfyZUEFM[jZˉA%yAvݟ͂ow2ff ;)I۸Ζ|J(t_S9Ӳn[2P03 %H%zc?t8E)ck(-m]!z_rb0y?ڷe}H?>?Is8H^ J+ .BuNgQLjG~Y3JJm.vjo1?f}Nd8OZ0'@$ ;fGЩtFm#P}rw(S#Uc>aWA@Odkt.(>)~{mqD[UTlVeޫk)`+┓ 粿1¢@[G%%DD)+޷{aIP\rZTsV/Vu%$W7yƕI 鑍&kOr5 ߎ#iuC(}o8Nque>LJ煿Oo DJ~Wzd wa`eOtKw H۪ټrQ@PDS@qg͝+F `?4,9D#Dᔓ|Ey]N근dt?7;ThHX<Uiqq}'mZJMP/mo#GsV%TUoɖU5:Bj~<щ)`4 n?IGS'a2[(HX2)(7^'dvHΔq3s'(BA얣{Se*[.!-9q 7,'9o&IP1> Dۢ6P+n/Eh:):*6ZS/HrӐE4Ro!sa/NEӕL *A,fDl1FL;vh[NeË~.߳ΨM<m}0x%HxuJRF;B3~:}[*~_:EB(} \%wFwSTY0ܑzLY­'Nt{Yx<NRDٴRj8r8u s`jg=ǨLBg4OmUԅGǢG6i%r,ӪKPYv_uy7mmlo*pSBtdZ8M 7`4Y<\cCk4%(^A k]"Pk9'XI u/A^>g,sq:K$b2<SQn>߯o;_(P"qP윏ݖ mj6wMuRV}BȥEEBڢ0\V8Rm_GkM_-DBoHM ȀGG=?Z"2U&OyhOIH]F.tE #7YPz'ٱg8V/9^~@ĵ\з1S<<dE%|:J)(I".<ØT?-5+$ࢿ-gG} jY9O>(VݲxAZ .=·ks?. fGJi25T@[ǁR\}.E{^ZQci')*p+w#PcYI_Yd-o xG pˉ |x<4ocn" > jIhl'$ݛ!׵uI = O$/S?ݮT>Y^)^I9 't[g"'LѰdRr-* J)[˹b Kzc {bo,ek(ɝ]Á 'Ô臍;z% iCZfݷl%g^iS4&C;K{R2ؘ̅|+<ѯIJE X<\r`q> V%0{.:KSz\*VkCADP*OEo џ1Su >D$BGe d|[f6al<-A魀 L3|eć` M'YQBdc@؟zPQ;pNu&">fjjOopϙAgr=llsp5qpP?cFzJ< "]דpIu`k z*tCjh1 c%@Xtjk[YD܌Y̤Fg2y~fs! ];1ǝy{ލ9-&QEBe6U5>a{n/mzNlA2q N4^?iϙɀN^Xnˬ`/EXǴ@7gXERaj08rl3Dzg)@ϡjV ɨ2* H$roOVQS6e_A>],B[-{GTY:HUQE /;f܀$a$*4Ł޼at}E-6pFcvB`oQډeC2hUC^I4M`ڄ$U~͸C;׼9œ4:ȎAĸv&xv<n18%b5'#tz=Jƻ3v ش-ŀ}f/eMt Wۙo>n_.eXZ঄=)zde@䊨&b$)SYdE%<( K@N&Z2 <-;xNz9jvˈVHgLǛ/ [9+0"1wڢϪN T4z{Z(ͻedGm|MPï&P$z@Ʒc.x M;V7BGbWBB5Pq_ ˎr8'LuɄ㻨oBF',t'f Af./fY56Hg|/9]Ҍbڔ G]~T冡aյԤD-x>dǒ+%kug97l!Kz,T`*Lyթu4Tah#gmˆۍ l,irZ982'UY-C- l~1SM|H =M.u`fQquS DS}*|y( 1*E_zyFz|-0n> Y-sVؖv.c eEQ%PҴ4u;r&ȴ q1ôEaczܑoN]C8 Iј̷!TnZZZFڦlOaAb#J ʱ3ǾVxS]9ȏKL0ȣ#wQѢ%0=@eqT3<4;K"UvWdvbӁSJ`43BQ2ЏSfsl'r_MsLEg9ԂFt’@K[?ۼT3\ Hܲ,+A*6Y͈KԊu7y!Iw_6hRrg"C 7&wbbA*].ǐuJtΠQ[ ? ,J4rؿG|3ہ>]ߙzÈs-%~.s}]j6OJ[Qq-TՂN c6Zo+b%L?{\;w)+ҩ*l!b&K4/na&dҿEaDf(e|Vi$RZ^+sLdo,Y)֯ljSX\J&.E_, ?5F m&> x^FLݠcjBuzgwRV2kNPPHCNs  Mx`\q1-Mご \dY5A./zl5~8#m hb8w=ugk./-$3tA |UdO^e/xvf`R i'46"p0ǪT&D!D>)Z0:3pڹ1l:A#ǪHϭ9RXPc]0n5͑צѩˡN<%9N7B0y^a>{lkiV=]~|40$2 9{ "$C/ 1e[|iك*3#-221,܋?,=8 iCzY+]e]Ctk y&uAk;f %ns{®Yͼ)?ePDx%+2*TV+ wI;M 8E`Fצf)mհKd搦tp+T1E2%OJ(yըxS2`ޡNwSF=aGBiK ݱxvT1sޗ~yS=LSlp DS\ۗt~BaAt%P(0F2#F|mD+ڣ+;V)[lNPk=J7jZn.uh SJǞSN4qk\zϽ[sbjcntͮI00:)R@ɫ/0(]g]wm`C\^ryw8Iq9 i9[`8&7-AaC}X+eRrف8?ëw{;֕zJxǿ%E.'@:nבN@<#K2f}hoIk<`Tmj VǞ{\K_FgIsAo_I}-[o$Bl GNbRݳ@+ZuU)#1ƚD#a>=F]X*\M,}4 XIt俞dYft(7+(5BjK! Ce>_g G8 GH.6 yVl :9YwcA TY;i>ǽ J6at~$^ӏ^wk08Јg#elQ%[Hn NM&1=vG~ OdRMHbkNQ\4A"g^IM8|-=֎#5Qٽ(Ƙu!k;w:{RGCn)+n%շCW tɈYzW%3SOVܯRǠLo,pV,phHΐIbJ YW E: DП-28²f-#("'e=[76WâWvOHkE=/=3B)U5 qɯ0C 1kr)d@O%XK)7$1!Mmv`ȶ4-h5\i8Oq&tXb k{!muAn1V ;IԋxON) c kY˲O=9KGHC2y~^룱 dmKFCuA ].PDqa[o<'P[jCkE,*,ѱy !ghFoޒ٪p=W|qQ)J:Rk!X.>/I5c.NjIxZNZE?gaa$ 2ureh<7O?gmuͱhC](0|̊Ƅ_ QYt*IEh(@Wy8u9oAxC lfD' Żv6"[BJl|$ @(ٽP QPΪ-̇Y3q~2,Qt +,)zKa |K%t>wm  32f1~kyx]=үMf\PYlR 1O5&pi4U_wϟgZrdήc s qe%Q+G\[@tITG8LYͰ @9Lx_޴j8xk%&3UIwl0u Le 0Xy7r\A58{˟@sTxIER!bnW̹9TxWíEoiq: kÑzo \N`4t+zTpSN&:v5T4壝7k`I AQ i:kdRL) 58JxvhX N&AN|WZ+`kF#|0g{;^I$L(y4j˻x-K-HS#ٽ d;9jnGXybX#]ޞ\M8ղ y˔tiy/y*=RVj>aU,{lV2T;kH205[-˽f1C]Hˎ9"p8+D_lAMsycc&5vރ $jM]ZϺ8v EaNiE+-$GɲNak#Nvx٠{-m8Ÿhs 6^:{orY~}{!ԹaCQb dѯqn9sb0R^/X`nlc PՌ,2 T~<,CFJQCiM_q-3ID0vW*{}gjߑ 6-^6Z mRh_m=XcDUNA^B27Zըh?w;g$  版ZFB[,VLk)It"]8ju0,ݞ$[ꖄ2ݮH@viU4 /S׃()3KWSGӷ+ᚅeػr<83"P~Ly܇;trYڰ}),ABTIVx~AK ||pBV mOwaPRۂv'"sԕ[L/[!Qn[zxiWJP'L4'rbmPj{#s0onq[?eHSYBu9H$ϫvȟt>zlFT41D+֛wv3b$Q<ۥO_/ڸ^!d&ex<@9gFoT}j>piN<o[iSqsѝ)3Х 6b#+~-;Q u2Jݐ o'x |ӯͶBיfܘJcl3CRta|#˪ES-a2[Ӊ.PP7A?D@1Zn}`  0X%7*imt",@<1 E"뫒UYbV+ߠWJU{4|ab>m-L'0I_35zZhZ$qːI^vT5l \sV,Sgw{t: rf7!NFqnq|Dqo @3?iA?0 ~eW3SWDX͞ev2t+`,իG)6NAAJ5}KY9(os \9 ]/ &>fZi.ЀJQ)K!ϒb>gB$\H!o) +H#ĵa ~T!fJ/GJ>؏64_C(Pz,$ubctCy=x4<2Td3}5r-4}FS7RڔAxIESlɐSZ04Zc6Y.:ȅCEK)ŝ$ZfbpSxEN0-)+O&tf̓91IbQftDP <—X!T ,EJ~}Y8ThB\U~KkXA[k`R 8I %NQwԫ$I>T*` F1xOE|^‰p%ҼDVxsNG&7 ՗b.XMw=V뺝V̊",xeZXqoɮ~ Q6 #kLٿ&+h0= X1I \GHk9{3RFC!coջ xUc#l{9B# {N6\% [tv &RZ7맀[]MÚ\8M+0*O& 0&=#OV 5$ _QyuL 1*hQ1g0B[D͉֝vL_0g2l ws#^4V)޹Ͷ(EhӹmjJ)A$g$'@ntwC209.ra|HwNQQz4w6iOW>@F8|^=b񻼑O{wz(9V3ظ`pWeX :f U5nc`pz3 Mƫɥy?+F Fw8h0>b zg\f x~(zKp2[t $?{c.t*4AMYOOI4Łh,{; NKWK%io$/'q+-2s5ʭnmJS^tVhsphq:|X G*sHW#{Tlߥ\1pOGP 0jV1@{vdh2i9vUz*EJ{+Z#+N1;!hv?z6O$~N'҇*2z|~HA^wWkDup!${E܎߸D/)9Wk3UNj0 t)Kl,>+Ƶ2V}DS yl˛]>j^2|hr䡑 Sk%% :{u.{'Fo @Ҍ0G^f@`c}}ú8Oz, J.Ka!jPIy 8`JpQõU FU _zod']X֌9}G^9;EY U3Bp(3#9uq%AyKg7#ӹ捺`ٸfLl۲iv-FH;;}1I %2 4.HvqWBUqU _šCUkMLmȽwC .!mD5aGEvWdTv Zt9-PհPmkI  L0_%!16W;p.kdsΉb4.2NDĹמ#oE>QTj'T;.tŦ]3 йvucAL#!8g}6".wAں ԤcI} _xÃ=`gEYHCc2u}S󇜮oık^$^^ޮC@ȸ_ոshaq8L"n=ٻ^ bFYj7\ix(@ 1~z0nArTǒ3?mx$ Y>~FWŅײڪaIC:L ]*>[L12P8 _?F%w [+C$#6R&p$=oZְEzbS-lAHN8a6c[q- kBQEnM;ɔH䡩nR&9KYK <&shꎮrCOϔ (!Vt2$Ɔܾ2Uf/,B6;un C= 4>н6 C NP]O^ ScY_)X;l{׌TU5,Yxwۯ}cJGQ]~Җʉ7\H޾aqa|`bO6@r o:&M<) [8fG!cR.ȅS 3bR]9*@:%_hվ`Zc E02˃ `(V?h|^Wo,zc7K7zCmp"Q9(A繎ɴia)jC#M<7dOT@~Y/Wf yB#jbRl0w70 &Փk43`-G%*c5@יt2gYPwZ]t!&+pZzX̳`fVuU(KeH){?AG ҥ7.a+<+>is'2Ü Pdx`{vJ;:M$CNQP3ͣn<%AMAAGR5ɲl 䲨LA,m`_{j}1y|għJ#'Y郑C  uV#]f ."Edoi1M+$tnaxUceX ';2k#/gNȚ^$">Ҩ𬶒) NǷ3gn02 /4/Dy{$"`C1bM>d g ac$Tס4Pqu[i԰]wspKW A}n_L%Yկ/TU"_HOn)y]չ؄m==]o¥)f]flUt(9c i+65o2Xסd(\yoPG&>z:ۆ.uUe{Z5G%*;mΝ q+(= <,mq`#LIJ*r x1N_$ڣL8Dt m"خ>(iHV{O*rk@eI%sɀjѾ R%hqFr/Y$1%Uy`AziaUA r!Hps9I!7>)Nd,E^:.lxb;N 튨3;,tqY'gF7KO*dL=ɶ~UޔoOXUf3OL j'tX0( uS %~e}-@O]uNZ's<9]78OoBg!^.co'fFLY<) }42IN3yBZOI&²g5l1OaD݃\CդmS2qqti>csJ% h+Z}QhZ-J،b}A&P#yz*٨{L9;@@z;&@ʼn8;\=mޅ>(x%ݤJo73hZ7#I]`ԕtG-C@APLh-{S:맊װePU@$ʹRiK5s&eL`YX+d/lo_p;n ⪩L`}k?\9?% ; s`,z3ER^yHcW9+_DZպ+<ø%CO l0 䋁rD :xnKA~}n7B-?P2k!LXy$!, *_$oN^0]$>Ûh`ۧ9gD9N4uŚ@#K 0$GGcBk##J:ӻ,L`ܰ[(Ş*D=ңVjs3˜:'Cֹ6D'Hs-%lPΛXLG/cll 5!ٜU/Fǯ7£_kk0T1M#)ewe_ (7t,MO(,SkD:W~J8W'fM󈜾vMZ,S3b( W&~vr`0|uDrG%1i\*/Z˺;doEǗMe qoR$JiŌ_f׈ ݪ:Fu.:N&h̟ʏ>0bdy~+{H cz޵~j$c][U+) KZ= W0tashJSaKQQ_D,Qԁ-nP,~Yԃ2 "]}ƻ]?Vmɛ!6oL> rj[8b.{[t}mdP[" xzw 6{v c\$~q*lM>n &4p ٴ)X+E,"&M`zF DTs!"eRT\EV2챕( 0RB6u^wI9*}zհahSYP+ 8>? p$I4P$#rz.Mju=Lm-eD=q\t@/̤,d> .t^As]\9KcЅ8MY_0i h>z~[\bfGINSJƺAR&16CT*!n;gZHB~ DD 'Ced#_;s]cm[p3j)jg|7 T%#)[J?nol[+ғ䃅.qR!H^ٝ\0Q[]FadβE$y1Kq ,eKAyfQ!@HY#/vƮl$1ءoG\~Yt)E|ܯ4I%{C'pt=0Tn&=&XUT*o"-vs9R|#,|ҙhJvHUm#m-WKԜL`}3nq|A 6)^cX-d$W06:D߲Qp=D *T~h6Bc9S\j\a?FVbt2':FZ OQƑQѫ~a T2=UfYVD?T=h]1"[X'$<{).n=4^pY@ЪDm ?PWq!`ڜ[EMF$XQ+'hrQF\yryrS[3\<9$,ۗUjP˶qq!̽ǿr#@q)~aV%iڝGC9Eu*0]&tmYzY8EV9d*f<Ppo« z" ːyb؏CjTZD"*Co8{ҼgC^ j6[ڠ nQ" (;FWKhGU (6\Xw q5Ρ߉R :&blњihҺ=,'^m'7$TI?.{ QkVT/}) sŌλrIb^lK.Fɫ޹t}(uLtCn4K\JwJtZ8EAB o.^!n9dK)!"&U|rRb`P+G=3AyctV]Y>MF@=z&jA{Ӈ$GFӝqE0o[kEޛ*)#p-QDFeiz=Y9%P 皛э[ z ҀtH`(/W#%v#(  Q89Pw cB*[,)y&xokȗ_!R,g.>rm0V~Ѭ&BAtWJ5 >gIke^BgE ٖ9X+J( |(Vg\+0JIuNse'.w$7(>S.%ðʯfv_d>ƹ6~ٮ*kFf(CcQ~ 鈉`GeIO;bZˎtI+z9sc3#J*0>b54BN;\o8`{d-8Jg?AP#G6œ*a 5JUv Ngtt)8]tPB&aGKF)[Xk?7~߀َެJE"M-L@fS[ȾOG=k>be[B=q'#X]}})êF<5WI  &|zǿýSE=R*\1H+,GJO(Z@@*II2 hlCi?!hx8d28}|0taj8y)ʄx]8qk|pG7 ٶ YZ