` ``@0 C0T7QT" 3 R @$( U|R I``` ```@``ﾭ (OР iHMP  H4P qOР iHM  H4P dOР iHM! H4P WHOР iHMp! H4P JOР iHM! H4P =OР iHM0" H4P ;hOР iHM" H4P )/@-X?D5tРLРLVHРP L8((0 SVV 8 whh;i`a8/*/0Od@P TP  Q:< 80QR:/ss 5 - $M<0 @DH 0! 0 0 Y$Ѝ/s@-0`40P@02P  㖊PlL`0T\\ F  r0S  008 T6/ЍpHfOf1fgtf/@-@40S P@rfffp@-`` @P p  @-@P (rPڠP l@%ff0/@-%$0 4& 8' <|S S@@ hk)(0 4* 8+ <0-,0 4. 8/ <0 厉(oboxff0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l 0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL/@-0,4^$[DX@HT2f>fGfNfH D H  BH /4 9 ~D0 00/@`//@-ÄXfp@-M@x 8 <d@P'b  L8L <0 @C4,00 4$ 0$ (000  00 0 VNnZ z C0c0vV`@0 @01 0x$]P; @[8 0S@DR@@G00-| QZP (ЍMZQ <xwP0S <pwP p @ YP p( |t (Ѝgfff(`ffJgfA-Pp @`0 0U 0p`0 jw P*wP  HwP 0 /ow0P 0C0gp@-P`3@P0{pV00Cpf@-@M@@ w @ p0#,,#4 <0Co@Ѝ@- 0@#$(#4, 8@p0#,,#4 <0Co<0 R/A-`P@P@ .<Ġ< . 00<P0Q`P&<twPv0iffM-d `00CpCR @L`U 2S 00 @dhdhdh7@-00@0P00SuP px0 RPxPx  P Ѝ0urP000S 0A-P`0p0Fv@P uЍ020S@d @ T 0 h0XPU@ q@PV 00Pt@P  @fp@- P@0t00P 0p|YA-@`P0s9 ls|  p0l0Sp01 0pP0 00 0S0 P &plp 0 pP0 00PPdp0W0  P o000Ѝ 5prqPp op@-PXpX@P% `P p |01 00 CP  Ѝ o Pp4P &plp 0 Ѝ@tp@-`P\ @T0` P(0p@-@$Y,Y0Y<XHXL@X@-0@S 0 000 0 0 00 0@X(0S@- eP F/@- 0@ $ t@ tff@-qq(PP00]P00S@-qq(P0Q/@-@M`p.YPP @ 0000 0`@P XЍ!TV@@P0<00S //0<00S /%/0<00S /%/-<^ /%M-p`P0@TFu@P`Ѝ\ZP ` 0 P0T0 S0[tP `tP n[ !PU|lPp@-RM@0`x00l s0X~oP P0 @P]PPU0@00(0Ѝpgf@-@0S @0 KP0(00<0ЍA- MX8Pp@` ln0P P0 R0P 0 00 P00 Ѝ@-\o@-Xo000p@-Qo@WWPPp@p@-`@o@D|00PP 0S ttPppf@-)o 0P f7@-Ps@Po Ѝ07@-P@P Ѝ0@pPE-0P@MЍ r 0S `rpW@DDA2d48BT0S pDPTl l 0pP Hn000`P  nP mhmhdrhff f/p@-XM@P  \0<`00000D 0 0<P@ P XЍp<P Tb`s@-P @`"s! @ 0}Ѝp@-rm00hf@-M@@sP0S 0S F`VP Vm`U p p 0PU 0SЍP P@ <vj@0 jpPp` p 0 @jP  p%n 0S mP mPH 8fvg(f@-@TT@TqfyfM-p0M@VPPAY U l!YPWPP!0Ѝ 0 X`P0 0$00 0hP kT000 `rP(00 0``P#_P `, ( B ` $`P0hP0;T, 0`qWfffffM-0S{ `VpP vЍ0J0P+ 5rp0 ^hVHTS* hPP\hPP 0-?  8q |^P S8PY0 1010  Q :S0! 00*hP Z 0!010RPU WpP$<$(<0$$,000L-?  ZqP0P@ff f@fffflfA-$p(`X @,_P<D0SS "0SPL3q0 0SE @$'quUP 0#,,#4 <0 Ri PqXP q@P PP VS|ppKS%P` :PP L?S0S <Ѝ0S$@+UPT  0"\\"$P,PUT #,,#4 < 0S00T0#Sl@xppp@0#,,#4 <00fOffqfffff$ff9fMfbf{fff/@-`@p?PT?P@pP8|pE<P$HPU k00!0>\@W !,4,8!  f@PP0S 0S "<<0"00W f >PP  Ѝ fffffMf0/Rp@-@@`pP0pR F@P@pp'fOfE-BXMP`0@pwp00S:S#SQ  XP 0 S SloЍ\0 0 G0RP000000 0gwh\f@-@@3Xf@-@oPR0#,,#4 <0h SdPPQ<QP, (QfffV'fffffRD0A-Pp`@o@P`U@gs@-@PP ,0`$`co 0 RЍp@gf@-0 ,0(L@L }XЍmhdhm۶dhR@-kg-M b:oQQЍffM-@P`dXp> )X\t`jPt o  o o0@( o0 e2"TP nTX @jP6mo@dP@n .jPdЍl #jP dP Ln< jP hdP  n jP0o@sdP  niP o  o o0@p n0 fA-`0BSpP@T WP 0 DRU(0^0pA/g@aR@-E~n@n @Yff0 mf@-  m Ѝf@-@8gM@P`U pP< 0@ |0U` @0pSPPH@<m48,L$ m_v@P0  m w@wmT%mmlptl R l dc`[m&gߍth `{mfffffff f!f+f5f;fJfߠg\fnfffffffTffRA-@PD`B p;VP 0 A//TgR p@-@m Pm@g 3mp/f-$M g00 00"m$ЍfE-PM@B00( 0p`T0 m OP Ѝ0  Bhc!0C0 0Pe0000q>0 0P`wh@gxhM-T눠刀P-O@TH0h`  XX0@D0PplHD 0 R4l00Vp@fgGfhbfWghqfh 0 B0 S 000C P 2#0//@-@.PgphW` 0@0FS`FP00 P Ѝp V5P  P 0d2#0P` V`PV0  S 0P0S0PP0;S0m V 0< ?bcP0d 6#`VQ0@-QN W Q@!   0h 0?R    ,,   0    BR` j    Q [R0(100[ ; ]R  R R@!   D0]Q00 : TPSQ 7h :  W 0c@P)c 0  W  0gS0W0vW0sSp  P @P3n[ s[W4Q p{M0nS@XhP0 RS PnR U N&) 0[M 0@P0sSg0!P`P[ @TX0vSLT Wp   h@TpPcP%T0 P%W T1#,,#4 <  hgW bPpGPb`UvPTwڬ0 KgPTaS sSW}PT`l@C@lS W4 W @@ )PPP}T0 0 OPP 3gVUP,gQ %gH FNX P& x6Q ppAg@TP %L0@SO````````|`=@DXAfT tP K0P#$(#4<M!<< !0PwXLXAfX0@AfQ $fAfX aPOPW SP?PcSP8P0hSW00gSld@aP @ T1 #$(#4<0#L$L(#4@<@0#$(#4<_f00#,,#4<  Rf00#$(#4<Ff0l 0#$(#4<:f0@0#$(#4<.f+f0 0#$(#4<fT'00#$(#4<fT 0 0#$(#4<fT 0p$0#$(#4<eL<e4 6aPWW_f <$<( 0 00 !a@PWB f p f 05Op aP00pScL\qPXeTeX0 wL@PGO$0000 0e%gnfffvffffff&ffffO gf0zh$ff1f?fYfgpfgwffgffpEg~ffgffffffff\gfff:fIf`fvffffffff%f{g[ff)fDfvfffg1g0~haS f p@ f 0PPeNpIdS e,QPWN; u`P@G@WPe@ ePPEY4 37 Y`P|W eh5)Z 0l0T10S0@2N]gR7@-@P  9`P@G9dfPcfP Pd Ѝ09oeP (9 0 Ѝ0@ffff4~hRaRM-phMP`E1eU@ 0 TPP0 @00 0 00d0 6[ P  dhЍP)P$  ,, 48 ,,Ġ ? |0 @ [ P00@F/Egggg@g@- @*RdT T T dTA00*Sd$S/0{S  /S 0}S00:M-Pp`_lAh c_PK~_XGVP! @G_U?t``````oPPP @U```$`,`4`DoTTTTT@ TcfgR@-@NP0Pp0 4FP o/g0P@- R 0S\  ST  PSL  0<c Ѝ\ P gggggA-쀟p@`PPPWP WcP`vP 00@P 0 xRc @P TX0 GcLAT$0 (;c@gfg~h~hgggGf#gR@-D@@?P ,0(0P of~h~h@-*P 4000j@P  co~h~hgBg0 0 0 /h~hX~h`~h,0 (0 $0 0 0 0 /T~hP~hh~hd~h`~h\~h,0 (0 $0 0 0 0 /P~hT~hd~hh~h\~h`~h@-EP @Ep@-AM` O@PP@ 4Q`bAލp@P_ KP P\P P PP P/ bg8`gGf 00S/ 0/h~h`~h$ 0S<#?/t~h80p@-4P@T(@PpDD@D~h~ht~hM-KMl FYpС`P㪏ı@[^ D R D PT QP] P[ | p!Q EP QPP @0 @FX P  $b >@P0SpdzQ.D FyX0U0C0P!V`1@@Dw^0 |@ah P HR0 MPKލha@g'pgGfp@-@P0P1@oU@ bb@labd@PDP D1^@Tu0ap a0Ppghgg"g@gM-$`@PU bPV  bVP bpP pZ a]Cpq]C P\`P  trapPX6X`ha@Z @ba$]CN]CPЍ\ @P LapPe5@@a5%P5 5% 5 5# 55 5*4005% nCP P@gC`b cC_ @ 0D 00S0+*WCS `@ `F0S@`CKCF GC`B CC? ` @@,"/? 0 S4 K `F `_ k&@t00(C0" DX@`F= R1 $`@Q  0?S@2/00VC <#O?@ @PC P) 00#000@ 00N00@(t3@00 -x`30S0 8303/SX<0 8R010 0SX b p00Ÿ02#0 S0C0Ÿ0 0CS@I~S@D !S@? l @S @5 `@\ ?\@,ŸS@@& ŸS@ @- S# @  NS @  1S @ S @  "0 0 00@~00000 00Y00 @0 0q00#00@Y00 @00@ BX1@00@Dd`BP CBl\`VTl0  _u _0@Pqf@gPrgxg@ggggg!gFgX~ht`p~hl~hH`~h~h~h~hT~h8~h<~ht~hP~hO~h`~hggGf"gRM-,`0尰尠@0Pp 0J@P `p X P `pw0 T0PPp@Ѝ~h~hh~hR@-$@_ w_~h?gR@-0 B0 0 ;G ЍVgR>p@-`{JPP9_@_P U0U0U00U0 R  BU0 R  BU0 R  B0S  /pRE-@M4`4J@P<0DS qp_ܠ0P~_0 y_` HP @ T0S PBP @l0P^@X ^ЍT T00 `@ f\g~haggM-@Pp `IPP+ 6_10@|^U`Ed^`\d@PW @P< -RW `e ^_ R@`ЍUW@^UW@^`UW@|w^`W \`n^UPi^@0`c^U,$~h~h~hgggThgggR }/R v/A-p0BS,ZIPP(^0 @ ^X` ^0P:U``r U @` UP`*~hR M-@%I`Pz^\Pt^Pp o^ P,G@ /~hg7@-P@Z^0 -RP^ Ѝ0p@-P @Q(]0 Up@] ]y g g gRM-XME@`7P 0=0P7`060D7< 0708708007090(703 7p0<0YP0ӅU= 7 6U 9 8U ]U8#80700S <XP ts] XЍ]8/<0iS4U6@`,v,`@TZ;00:0@ M/P@ :0$ 0;g/P/P/ş 0$ ,P  3]@@rS6@' wSa6@Xe08PSS*!03>0 .P0  ]PP 90R`S`S* ]@@08pS!*|4< =  l46 d4 \48 T49 L4# D4 t` X \H\P .P  \PP9 3R*@@mS16@sc08PS#*04@0 o.P4 0# 0 4s.P \\T\PP90S*@@( <WP8 Z90$0 S\60(00S{:R@` @0-.P  m\0(0`@$0 R(0SD_\0Tb0$Z  Q 3Rp X 0C0AS 0 H\0 0 0R:@\1`SP 0R"P0! .\W 0%R $3@P!0 | Px! p \\ 00R 908T301,\WT2R,0',0S SWR H <1WPqU-I-~h~h~h~h~h~h~hO]g g gSg g g g gM gpEg| g g g g gq g g gfS gdf} gf g g g g g g g g gs@-`@ PJ\QЍp 0-R  R  7\00 R RM-P0`M`5p0(0 50,0508040<040004040400-4@`VP00xS,P 80(0,00@S ( RwV $0SrV0X=`Ѝ0rVpH0 wV(W [Hp8#80W= .VP, J @GV`0< 08@ 0KrP4 0kPpGW 0GSW ,@P , (YPlVN,0<080,P @80,0(0T, (?P80 0S4p0SZ00 00;/PP 0S0 ( 0 ;/Po 0PU 0S0  Pa 0PUP$pZ$p0SP80Z P0S.pZ,0 ;/0S   P TZ/0 $0 U(Z ("({Z 0SP/Tr P+(0$0,0080 0<00000rV40 0 wV t0$ `L0 H0 @0 80 00 (0 0 8~h~h~h~h~h~h~h~hg)g<gQgeglgpgp@-`@xVV)PZ?.U0P d 0QR``VP :p0A ^1#!0<Pd|Vpp0P@- Q 523:0S\  ST  PSL  0<Y Ѝ\ P gggggp@-@`PPp 0 ``=P @-@Z 0gS KS MS GS kS mS    p@-P@T 0 R Tl l !P0Pp@< 08#8 ~h~h~hgg0@-@MT 0S|  St  pSl  0dXDYPL nTЍ,$0@~hgggg~hgYghA-,0`VP@``000%00S0. 0V0@`0@p ^W  @0 @ P iX YQ : 0\0: 000~h~hg0 (@-,@p,g-"/T!#?X"*&,#:."%+#55g;gAgGgp@-@ P0 PP<80 R , R  0PP4p~h~h~hM-锢Bp0M W00) |R0TX`0 B@:000`PE 00V0 S Uv ;0PE0p WPP0SoPl0000!SP [  @PE  R?o20S X 0 0 RS `SU 7:@00 PE@ 0SS0S 0$( 0@)@PE$0S U0r  o  PE@0[*U ,0PE0`$0 P [0Ѝ~hh,gA-P`p@PT@@ 0 pp<@P~h 0@-0 0b@h~h@-@P@L L !0 @W P\ p( WЍ\XfgLgQgM-P!@ MqpQ^*W` ЍR0:0St Sl h"Sd0 XW^*@W0  0`P p(P\^000oQ 0S S !S0 IL000oQ 0S@ S8 4!S00 0+L T0 [\0S S S0  RQ    pZ\0RQ\RQY p gggggggggg@g@ 0@-P@T \~hM-HM@0`Q@0D000:00 )RpP` \@PpG UH V00HЍ RW P Q0P0U ;R P00 0 0 0  0Q;QppP9 ;QV@ @<@0-S"p@<@<0@S0$0(0<<$(<0(S00!)0 L0oopP0ZbP IP  IP  IPj8 D\PW8cPT&@T 60 !0000L X0F@QPLpPVL < DZ< `00P<0`<0RU` 0  R0` 0PM`0LP0'ZZP ` 0D@ S@ DPP bP %@ HP 80Q0P00 D܀RRWT= . 00000 080S 0 ؀R@TK 8 00@%M83P $P 3 MR0@ 0Ja0  0p[83Pd#P  @3 L 7HPV@@" SM ?X \0LMX8d@P$80SL , PX0@0c p`X,@ CP p0b 00 p pQ@P7 L@ 0r1P L @PXP 0P@ 10 000000 0` RPd L0@p@ d=8 0<#00,0p 0 nL``f `X `1x0 d 0|00l00`0`00 0R@P 0p`-"gdhqg f:g4"g3"g%gJ"g"ggb"gp"gv"g"g"g"g"gngff#gh#g|"g"g"g#g#g#g#gW$g$g"gf$g$gg%gH%g%g gj gq gt g$gf$gZf$g%gr%gy%g%g%g%g!&gA-p`Pd@ 4P 0 DS U40Q 0A/h@a@-MT P(*KP  0h`@dp,@D 0, 0RЍH UT,00H 00K,@,@Dߠg&gg&gR/@-@!<0P YPKK:i&g&gE-@24Mp `P寸 P L1UT Ud UPl堸+YYPPa1P fZ  1P ]Zt  l0S ` \0S P L1P HZ8  01P ?Z  1P 6Z  0S U! 4ЍE KPF0PS\0 0+0K00+00P4Ѝ-i-if@gf1if2ifi fi&g1if1i f1i&g i&g]ZW T@-DM0@p `$0 knWP B P @DЍ9 P $ 0/u@ T0UP@( PT@p (JT  pdf&g"giff//RM-`BPp@䲟00S P0E0"P" 0[@oЍ C R񟗄taaaaaaaHaxaaa a@aEOoBWOoBX{ @@@0ppE@P@EEEOEP@@ J @J@DOoB J @J@T@ J @JT@@ J @JT@@Ө J @JT J @JT@@0߾@S S Spg0 `V Qg MXZT@@fA-\pP`0X"RDI@ 14@T`dEP蠁h(gA-@`PP tp 0Ȋ@PXId$P`101101蠁h(g@-WP X@0S Ӂ蠁hA-p`P@P l0\0ːL<0 \*LI 0)@P,Id A蠁h)g!)g0M- M`P~@P 1 gI Ѝ _I % UxUIPP0l OI1 $PIIP0T S D`PV,10;`C`0c` 00P01I Vp1!pD0 RC000 ᩌP IZkC-D pR0 0J0 p0 V01 !Z0=)gF)gk)g)g)gh)g)gGf@-`TM0@SP ;S 8!DPH@ ,O^M ppH@TЍMU8 p H P @`LHHH@0 HꃀP$000ꠁh)g*g g3*gF*g-*ghRM-M@Ѝ@PCPЍMCPTt:Qh H;$ 80 P H@T ЍMCP :0S CPQTi  C@PP0`B @ ;8ZH`+d;"*& C:SHl A%OH LHt IHp FH CH+t ?Hl CPQ Q13 #Q1@2q@q@\APQ/.P+@X  0W $ @G` XV+ d EpꄦPB`PTPXF14P`0X"VڑdBP| B`PT` Boob $H8 BpP $ BPpT T Tp  0-S  H @050D";咣 03GTXP0g$0,00 6BB ̴HDH00B C P%``V$ 2#/ R XR V G @F[r @0C0S;Vʄh_QVT|F$@p4Wll F@6D BTPppVPP hc$ dF+R F@#@ 0FT@d$/@P.gb.gi.g.gef.g.g.g-gfg*g*g/gf2/g"gD/g"gH@-Q8ER@$@PE꤁h;3gfu3g@-@00SERP ЍF 0Rp U`  E 0Q P  pE꤁h3gu3gp@-8P@0S000P 0p訁hhR/0/ᤁh@-0@0S$HE 0訁h3ghR/ P0 Pa(aaa a a aaaaaT/P SL/D/@/</8/4/0/ /$/-5gg{5g;5gI5gY5ga5gn5gr5g5gPp@-P@ P P p@DDU U DT T Tp@DPEDUaPaXa`ahapaDDTx PTp Td`\XTP -5g g5glg5g5g5g5g5g5g5g6g46g#6g5g5g5g6g 6g1S/E-@Q!gl0#4(Hp D?P# 0 D1S$ D!|D0! S0#!yDC/0BO #4 XoD Ѝ ?P?P!)_D>6g[6gh6gpEg6g6gs6gE-@MP?`MD, ZAp, SA@P, @ PB,9HAxPC , XA6DVX0  Ct,D W 0|  `00!00CS4!4!p(H`!10Dy?P  0 `DD, @ PЍAP p@C [?PW?PD0 ?@P @P @P @P ~00 @ g6g0 gؔf6g6g7gXgvg@- M@  < f Ѝ@-@ xCPЍD0 Cc@P D0 ?4/Q/@-M@@< P Cލ7gM-PC1@!  10010|C1S pwC`rC@1SDЍMiC4fC !(bC$`C#!"!UZC$1S UC$PC䰟J`%1 S@*0  ?C+10S S S3C0.C+10S.h'C,%C ` pS7g07g"7ggi7g=7g7gpEg7g7g7g7gL7gO7g7g6g8gnf7g 8g8g@-@_v, ?PЍD0 @P @P ?P >P ?7@-P z%BP0@ Ѝ0D0,@0,@D, 0R>0S ?P D0?>0Sꇤg@-PG0 hPaR/p@-`MP @=P @30S4BЍp  =P B˦ =PU %~B뽦20S|  =P$ =PUB@p\Bp@P`w L =PoUӳBP\`PAB B 9PP0SSESF0C S%a%a%a%a%a%a%a%a%a%a%a%a%a%af0C  RtpB@U* \B0h #0TdX%X $ p AA@A@A@A@A0h 0AE #=PЍp@Fx |0Ѝp@fh'8gvf88gJ8gO8gV8gf8gTf8gf@!a8g8g g8g8g9g$9g9gO:g4:g89gL9gf9g9g:g:g hM-`2M@5p0$W.BW@( BWP#  B`P$l A0#,,#4 <0!SPuAЍP`00Sa0[0W0SXZ \APp lUAU\%*0 W ݹ $>;[ [ [ ,1A <#'A 0#P s#A0#̠$̌(#4 000 0 PT A@g$gT>g=gV'fff>gfffD>g>gGffu>g>g>g>gA-pQ` -R p @0h0P0`FV fSp 0SA 0 H2PPPhVh@-鬯PRA-@PD`B p)P 0 A//h0@-0,MPP 0 0 0 (0P  0@T \@@,Ѝ0@0 PPP<2@P"${@@Vh#?g*?gRA-@P0 -R0aS@DP tp`V@ TP @ @V@@PK@p`p?gO?gM- M0 ` 0 P HX= @ -RF S4-@ [Z@XpG `;PB @X@eUPQ T\ @Dp⾶ 40PY X" ЍdR bR cR rR tRSN0 SI0 R@S@0P`U@ 0 R0S @T?@ ?X`&0 0 0 P@2Px0x?U`&0PC0 0U`&000(?g6gC@ga@g?g?g@gVhTi@g@g@- L\@-T ^  Q@T aT fT @( \^ @gR-,M00@ 00 0 0 (0 /o,Ѝ/VhE-`,MVP0-S =:@P\(T!V0000Sp0 00,Ѝ`F0S fS9:pV@#pP?0   BQ PWCh000000(0Pp V/,#0S(0 >AghVh>AgTiXAgR-0@-@0AMMAލЍ0P0P0 t >h aP0L Q  i0 P 0/ gAgAgR V/0/h@-P000 00 Q, 0S  ;ЍAgM-@M@ p P` BR'-Q. >U  W`F@A P |0@` 0 P0`1`b>@ЍsQ bQ cQ tQZA pZ= pQ @Z4 V@ЍMV' >@ P > pX00@x@ 0`X 0P @/`PX U E 3  VhTiAgAgGfAg@/ {@-&HP q&g&P &&y:DgDg?\:/ /@- @"p!p||0h | | X| P | H| @| 8|0! | |$|(|,|0|4|8|<|@|D|H|L|P|T |X |\ |` |d |h |l | p| |t| tx| l||0d 5aa|ata6P.W0Sp@W0S00%6 6@p @ 0ZP@5P 0S l:@1f؅h EgM-@P` 5pPX 5@`5 ` 5PTЍU G  @O5`p5 : 5P+ ;PP8 PP40S 5 5P X 0 9 > ? PX:  U!P00000-S =S0 +S00S5P [X:   0pS F5``@47535P05`@4`l#EgA-PPM@% @T" p 5밀@P 0S 5Y`440@0 0`)@tD0@Ѝ0@0 0P@ 8a7apEghM-08M@S `Pp0(0$00 0009 R Q R Q 0R RS 7 p8Ѝ00CS g0P00 S0000000 0VPPU PPUP0S@@T 00C0? 0 SR 0SN0S Z00ZL 000(0z4,0J$0$0$0P=0(0 0$ 00P0Uj*((00$ `P  0 BS/o" Rf ?o2QQa R00S~0 0 0 S SW0SD `o^P0S$0 0S  SP 40PC40`a 00l,0`F S(33 3,0 0000P 0 0S 8$S 0  PU p 0 S0S0000000S3pp 00S 0pS `Pa,0_,0pPXoob`V; P3=`3Pq0`g00S dP0P2 00S 0S `Ppp`G01S 00C0Ap1,0014040`P RV 0pP0` 0S0S0000,0Hp0,0[Q30  %1pwI0!pCpp0 j9304p,0VP` P20S @2 240p0S 230,00[ `;3 P ,076 00PA"x0p 00Sp 0S?o2 0R00W 0 W0 0 ` hg܅hh)Egvgyf6EgM-8Mp@ ߭ `P4p$PP(P0P,PD $4e,,6P0 0ĭ000S 00 03/pP? 50Sq U 03/[ ! KQ^R[ZP\ U X0S(0S[  0KS R [ X X;R9(0S6P,0S  c` v s  `4RL6 `u  04Rf00Sb`V`8Ѝ'U#!UU h3 ,0PS0S6000 000E"PEUXUaDSaSaRapUaUa\U |U ;U}hV 00#03/ PpL 03/z  G 03/ s03/R00  00003/0000_P0Sv 03/ o?P {P  $E 000`$] ZW 03/P 000 03/ 03/}Pp}Pc=00 03/'PpqS0SQ +0/o"0 &ZB 03/g|Z8 03/]00 03/Pp 0S( |0 ,0S 0j vL0  c000hrEgnEghvEg{EgEgAaEg 8ahEg1f@-<0080000 000>p0ЍAa:ahp@-080/ 0 @8  B8 8 . 8 8 H /H0B8C0H0//@-0  80 6CL0P垫 00  p R @-pll00#,Ġ ,#4 < ᆫp l / @- Fg@-  @6Fg////////////////Q @-H L B H H L /l0S l0!<<!0000t0tH00C0H0H0tp0/H00C0H0H0P0////M- @ HP<P!@(<0\ \ 81 3 #S41 B2s2 Bs0B0Q0CL0C?B!c 0 B~ `b0vp07 P T!00U U813 #S41L2s2Ls᠑ࠁ0L 0^0C0C?L1c  C `c╬1t' 1p7 Q 0 RP 03, ' hggfffGg4g4// p@-0 0PP4P@ @44 8 p@H00C0H0勫 00sp@-HP  `0Sp@@L@3/0P  B3(`fGg///0<00/$$0$ 0C0L  /`9ih@-@-<볮EGgD@- 7P ɡ0@l,勠  (MGg@gff@-U@P@  y3^GgfGg@- 28n3C!,j3(h30 c3 ЍoGgGgpEgGgT X Thb2@-8BB@E@-/////////@-0TP8<0080`0S @@L@3/0P   B!3G(`hGg@-@P` PU*P0S*0P * S@(: PSP#* S t.̠̌x.`Pt&x&dl`t&<NP_p c@P, % P@pWȰ@|V) x< S   S   S  , @0č@P dtЍOgM-P M, %@P `` P5Pp W p ,P ˟ 040#40 ⊟  ↟0 01S 0 0  S 000 90 t1S P0<0`0@S{ pSs SP4n 0h d000 00` tP&00?, `P,90p80Y pp` 9VrΕP P)Wp1$`dWd 9Vc`s` 9VcP0S0043@T 0 0C#0 0S $0Pt:?0` PV$0Pf:0 0 0\`S2@01S22p`P 8`1SV0hhd00&h0 000 0`P ݍ` <`{P7( PP0  p0` 0Რ0 000j$ 0P:   00J 0@ 0z  3  1S *o  !00SP ]0  g  q   R 4'U004Oghhh Og Pg@-#@9 R  /@-@M0h}?00 00  0 !0HP09h$ 0h0R8 $ 0h0G #ЍIp@-(MP@ 0h10P}?0 0P 00 0P!0 \# 0h0@` 0h0(Ѝp`M- 0@Ph!0M!0R3D 0G@A@0`04 0G@AdpWM h   2 0 0 W00}?0,00 0$ $ `9S< 1 0 09,0Z`09 00S0 0h}?0c0 000!0 `PI 0h0I0Ѝ,0Z [0K ,0Z 0pWg0@-000@%00 $0` Zp_0S ,#PU0S h&P 0S 0SS P` Ѝ1S S 'XPgM-M'`@P`p 9 0Sip 1#4,01-01SPB [ 09,03/Ѝ 0S/ ݜ00b02000d0 0h0c 0S[09 "0S"R W "-  , 0SSS S X -  , 8 !&$"  pPPgwPgp@-\@P h`农00b0200d00 0h0 0c0003/h`p hM-R MS `p@ "!HA㬉㠉0 b h`S'< U X!'(%X!000(%4",00 0400 h`d @000* 00 0b 00 0"c0 t0 P2/P    00S 0 H_f Ѝd Zp` hM-R MS `p@M "t!HAJ>0 b h`S'< U X!'(%X!000(%4",00 0400 h`d ޛ000( 00 0b 00 0"c0 t0 P2/P    4 00S 0 H Ѝd Zp` h@- h}?Č00 00 0ЍM-<"0M⣁c 0RX@'0 pwh0to``p1000d003 0b0 0 P⯛}?0q 00 0P4X0/\]! `0gh d0P0d0`aS ` X}/ P  h eP 9 X  Pp} 00 0 Op' 9 wpPP T0R0 0CS 0SdP Q03Ѝg hUSBCUSBSs@-xT`PPU<$Ѝp;P@w$PgPg0 /hP@-(f$$@$b$P`%QghQQgA-XD`&P!1pS="10CS9@8 pP"1 0#1 0S%PS&!1Q!,000 !R  5P 0S 0S 0S 0S 0AS$ ! 1$Ѝ+! R*   +! R*!  .!% 0  Q %0S0%00 h0 \0$9P0 S4181#81:03IaaQg$adamQglaM-MCgh0 0` 0P b0 500b0c20$00d0003/pP X#p"0S,0:S X Z&-0, "@# 0S Ѝ 2 320  02 E.̱  Z) 0$0U0^0  b0 20 0d c0 00 3/P0'p0p0 @hp Й0  0ʙ% b c"  d 0 2/P 00S<#0- 00p"<<"$0,0!,,!    | 0 Rp   R  \ Q!QS!030#20u hRgQg Rg̪M-`MP㾆,  `PJ ?@0h@}?00 0@000 |pP0  "0 000<000, x0 @P0 0 pP 000'@P t`Ѝ#@PpW@,@P #P@&Rgh,Rgy5yP @P///hA-`P8pH@@T @DHPDPhp@-PP P@P@pP {@-@P 00H LTL H0H0L h0H H L /h-TMP  P00@000<040808040@0 ,0<01xtTЍO8gaa|aaa qp@-` P@@PPp@ $00PpRA-`@pPr@P0XPpV/p?g@-@ 0P0Pf;SgP@-T7] I?0P0- @ 04/ #FSgp?gsSg@-dwM-pP`@.oPPPEuP0J*`ZX HPcU `@`0  B0B!dhmhm۶dh@-@ 80P -* ESgSgSgM-MPS@S100 M`A 0SS""VpP0 ( $0 P( $0p 0ZW `PU 00 `K!0`FqYPZ 0 P  eP `0Z u` `SgSg@-  \ P<080<㙄 ЍP00<hgM-0,p@"W(0` [0T0P0pG 00T0S [$ P ^@@Ѝ   R @TP 010 (`ЍM/.hP@nP@pG !@P 0ER _ P PW0 !@@+TgM-M0000P0$ 0pP ܍9`0P00Sl3|  R R0 R `0 R R R   V  <1V C 0 0$R0S: X8 0020, <ԃP. PK<a,匢 @Xu 0`dVP*Wa OZpc^ R 0c  0`0p!10CC,0000|0 PV|yP XP4,[1 ,@Z 0 ^0S @@T  X <a@DT, pgv댰,N`|p@P$TRdp0MSPJDH`JE` AEghhvgdhmhm۶dhgpEgp@-@PEP 0P.S0Pb0C0S PPpf- /- /@- @4/ЍM-P(0p`P @ T @P PЍ @0 SЍM 0RP W  000 ;/WP 0 u00/Tg6TgvgpEg8Tg`n`[Tg@-0    ㆛ PЍ00@ R/a CRWC/A CR7C/@-@PPM-@P`0S SS[  P Ѝ0Kp [ iHaaa,aa`aapa|aa@ P ppP ppPZ:PppP@@000P0p@000Ppp@@0@ PpPp@-@PbP}P[Ppp@-P Ѝ@-B*4S 0*4`pPH P`UU 0ES2aa|aU$4p0W$4/ 40 4tP- hP) UXQTPE;0p`44S0P (4S 4 $0#S  4P04V ЍP 0`0~P(4$S dh0 "448#8S08#8Q $0Rhh hh h hhM-hB0P 0B> T*T04PTT T$T8T4T+T0,P z?(40SCI4S+4 4g ı p`P ^ 0 4W A\J7 AuVpGW0 (4/(4SC%40404S ,04PB`V p`(PP4S/4 $0S0 Q  Q 0Q  R  ABQ xR00 AAPA ^Ua AR\ 0S Q40*40 404ЍuPhwTg_ vgM-Bp`)4S4SVS-+4S 04S ,04P0004 PPaQ+4S+T$ 4RM0 Q*4 $2 44S 44S9)4STUUP Ɉ4`F0C44p04$4P\PP00SS4S PP Q $4P\PP0C48$ S0C08$450C0RP'L[u uC4S0)4t(4SC94044P20)4U+4 0#  Ps(4SC!404h/P@- x@40CS   0)4@4/P@ h0%'5/ḔfTgp@-t t00C l@RP T 0R @03/P00p@T@`rh shrhM- 0S, @9QG QD q| ЍMF'Q 3Q Q fQ E AR132 E0Z (xQ Q'Z00E000 hdp 0S Tk Q?da$a,a,a,aa,aaE0Z VT`V- 0S* 4 P**5u0u#d)0嫁᫶S'Ue 00 0`xЍlhd`XЍMVgUgUgUgA aUg~UgUgUgUgDUgUgpEg-VgUVg VgVgVg$VgVgp@-P `H0PCD@ 0P0Tp03/P00p@rh shrhp@-@PPp@`0KS 3S S 'S 9S ES| s0Spp@/xSX ZSL fSD S8 VgVgWgVgVgWgWgVgVg$WgVgWg6gWgp@-@P`0P 0S  3/Pp\p%pp@-PP0@000LP,?  < pfJWgM-@p. PP  @E00P@00S`   `;ЍZ  x00S l  _@P00`  P@ 0S 0ES)UWg{WgM-``MpT PL @PwP@`Ѝ,  V |`P@  P p P : P ` :  K j@P [ R  P  R0 . s@0S7 ,0S; ` @P VL \ R\ VT   `[V[ T J R [ { {  @P; 6 R -@x0OoB[@T  `\@i L10SD100S000Q1QR1 3 #20LR ,P B P <  @ R   R  tP!PQ!3#" e/g;3gfWg gWg6gUWgWgWg5XgWgXg̪rXgQXgM-p`>PP@ 0S@ %@  P @0S 0 3/P @0M-PQp! # P - 0K  ` _P @PЍD w(00 0@P hXgXg@-0fS\  ESP  L SD  89S 0a0(2 Ѝ xSmfXgXgXgXgXg0@-P\M@ PP0S@T@\Ѝ0A-p@P/ 0<0S `0S  SPC0 0A/%M-p@P 0<0S `0S  SPC0 0M/%M-p@P 0<0S `0S  SPC0 0M/%A-MP` P&p堀@, lP @ 0  P 0  PiT ,@X P @TЍXgYg1US)p@-1PS&s/ 0R R0PS @S@QPpH 6Pp, RP dp/pYgYgH-0?0?0 0MPP0 @P K`Pd0S1Sd`h0M-MP`p0 W00 0M001 K $0   $0P  ! !UPR o/ @,\Z^$ Q  \^ <0 0800 080 ,0 0C?o20R0L00P0Q \  \^ p@R \R0 Q80T(P00<,0LYgKYgwYgf@- 0g ЍM- M0 X00 0M$  K7PP0 p,P  P !Woo1`_P@0 RR AWo0 RQ 0SI@T0 SR 0W$0 00$ 0 `V0808 0 R \0R0Q8 0 h0\h`  00 0D % W SR YgKYgwYggYgYgYg@-@   0 aЍYg@-@ P!0 S M-p0 S SS`0 @P0S W   'P W  0 ("448#8ጠ0 [ *0 P0S PP P W  000SW  H0G I0J0 1P W  0 ꐱ  0 08R#8S W t 0US0S W H @, @  0 SS QS W z x RpDSPWm  h0Sbb`bb`b->0  Q1!0  0#1Z>0?@hYg3Zg9Zg]ZgGhZguZgZgZg;[gf[g_[g-\M0 \Ѝ@-dM0 @p` dЍT P`P8p0 00Pp 0 p[g[g \g00E-p0`& P0@P,PE0, 0RT 0S 0SP Ѝ@,P,PEp@-`P@PT@pv0S@P  p@-@iP0S p, 0\/0 S/ဩf)\g@-`Pp@P0avP Ѝ@ TxV@` P0@0,@D, 0R *0PSpPP ,@ꄩff@-@`P cp P p0S U@ PT Ѝ@- K@P 0S@ Ѝ@-XpP@ 8p P` 0S  @ ЍB\g7@- P"@P  Ѝ00\g7@-@P\  pp< @ Ѝ0P@P 0S@A\gN\g0<0S 0S /%//xp@-@P p@ p@-@P p@A-`p PP0@ Ѝu0S0S@ ,@0,@D, 0RPE-@p`_0<0S% 00P0 AP0 :/V@00 0j ЍA-@pP`50<0S 0 A/%xs@-@ `PnP0 Ѝp@Ѝpxs@-@ `P[P0 Ѝp@Ѝps@-`{@P0@P,PE0, 0RЍp0S0T@,P,PE@-p PM-04P{p @T 0 `P( @ ?@P 0@ 00? Ѝ `W  [@P@ @,@ 0,@D, 0R@ 00 S|0 00S00h   R 1( R U1< PP3P#2080p0` 0x0@0̪A-0M @ `0Tp}APP @ P00L00H00 0 p|@P 0Ѝ2fp@-P@P  p B -0Q 0C?o20#S A0SRࠃࠓ S0@-#00 0A-,pP11` d@T*8h@-9 ЍM-`pQ20@001 ! 0 0 0Z } 8)JЍ00 1*< 11110 1*401*80100 1 !142x}Q0 l 2#>01010S0SS11|8h\g\gM-S*Mℳ`p D 20 1>pH;0pA83@W,m@OoVB@ %0S p| $&~00090$00<0(p0 2010 }!5)P 0,@Q, , C* .~) 6@ i0'3010"44!$$8(#8"(7840:';20 ,020"44,<"44 $ (ЍZ T D@[$ [ P  P [ 00   `p P \ W 00 0S P@  ^gmhmhdrh^g3^gA-pQP gP@TU pЍiQP 0 m0P0U0S``KP@R^gp@-`Q@LD0  P pP 0@04P`glfA- `@0PS00S 0T400 P,: 0SЍ 0^ 0Q*(0S c C03<2q(Q@ a 0A840G  P  0C S* $p @ 1S0102/1P/p@-@PP0  1S00p0!R !"/@P/@- ЍDh0P "/Dh@-@ P <@P  R 08  Dh&ag@-0@S0003/P qp@-P Q\UP@T P@pP <P@@DhA-P`쀟p@T V3 P `Ѝ0p/SC0S 8P 0S 0S S 8PV`<m@9Vag  BR (0((/@-*0S//᫽fagagagL-P p ^@:`^@^:  @ 4 LX0/M-0MTpPSPX2 \@`+:\\&:X0Ѝ`Q 1/PL0S 40Stl[@ 0 Fq0 (;/00M-(MH@`S/ \Pp(:\\#:dQ   Tp[ 0  T 0 q0 @ ;/00(Ѝ(ЍM/A-(``Pp$@PlQ`Q 0S ^@  0`1/P@L0S 40St@Ѝ000000 01/@-M(@ $ @Pp`PpQdQ 0S ^ 0(@Ѝ@/000000 01/ЍA-`pVP S \@ :\\:P A/^7@-0S1!P@0 P PJ00040<SL0400PS  C0("(RC8  QC4 C2 C1  0B $0R B !QB(PB$B"B! A30C,00 ;A S( 0 Ѝ0  0wP_p 8AfagagagDhagS 0@-P @U @:Q 0@//00p@-@T S ` PVP:  p@/^ppp@-nfP寺gKgM-`@P& =PP! ,pEPP K  B RW 0 S yPP ?P@[PM-00MQ .fpPW @cS0嘃STUA?t``/PUXV0T% 0 p< cP0 000S ;EPPPJP:;?o2PppWK P@#d,ep epr@h<^Xr@0S P0SPP0Ѝ 0R P 8 `<Pr`P\ ڈ`@@X 00@00(pD0@P  t P@P  tfPv 0R 0 P 8V3P0P R T 0RiP8H3<_`+,gLhHhPhagg2bgbgsbgHh\gbgXbgbg-\ //-|/x/-t/- 0d/- 0h/0@-@ R *P PT:@ 0p0@/0//p@-P0 0 0 @X03/P 0 rs 0S 0 0 0S 0 p- 0/- 0/- 0/0/ 0/ 0/@-@ 01/P000@-@ (P`$ 0`1/0Jp0 00C0Ѝp0 00C0E-@ 0RM` 0:Ѝ R   P: R. 0l1/P up000 Jp000 (PQppU 0 e E0UQ3R(`Q  a 0A68PE0 0S0P0 A-@0Mp 0[m0-S" 0 0 !0@S P0(S`PP)PP4 0 P *Ѝ0@S`00  P0;00000,Q rq00 LP  U  F`F00Q;Q 8v!  Ebgbgcg[fg3cgZcgbgp@-PP@p@`@P  mM-`MPp{@TP 8@ rp @Ѝ00 000 000000 0 000800`0SL5`0d0S@5d0h0S45h0\0S(5\0l0S5l0p0S5p00S50x0S4x00S400S40|0S4|0t0S4t00S400S400S400S400S400S400PSp40l4X0!sr 0sr.Gp$0S,p0,*Q7 $0Sp' c C83172 !00 0   R  S*: 0. \P~p 0r.sr p0 0S S2:0S 0   R * R  8 XP\00% p 0T 00Qf*Sg\ښpW p\:^1!-0 . 00$ R,0K P 0;00   00$ R,05w P 08;0D0D0H0H0L0L040400S`p V0*. 0[P00000`p0\0C0QcgOb\MbMbLb7<p0x10000000   $   "0B,0080 2&.0,  0 0qw"p,0$0 Pp Ѝ<`C`^ hpqpG4w^ `^ 080B00KSlbibmblbmbmbmblb0 C h!A0?2 B<@ b7002i(0 p1 c C3`s0(0:`0D00 0<(`<PD0 Sh1 23 < T00 0d0H000PX T0Rh<6` `b 0PQcQ`G0<00S+g 06#`<0     ` kRp@ f(0000p1 3@0aPV0  00h | 0 h0t 0( 0ကl$0 0$0,00,0P;0q0000 0CS!0 0 U0 O0  I0LS 7l 0 0 0f f0 :"ᑢ"0f  `$<@QR `Q  xegM-<@DuZQ@/ p!02h!PS"0 `P @! @  t! b 0R;"!X#Q0W00J 0 h0W0P0S@ Ѝ 000@J0  0 L@M-0p!@P b `B 1320x1fpZЍ0 3201f08!  R q h!p1<0CQA1  S 2A10 S 0S p!?2 B< b10"op0   B0\Q  R p!0C B b"30<ŔC\Ό<C0[ E-4MPT` 7Pp@ 0 0  0 0P4Ѝ0$000W  0W 1  ,  (PP up Jp 0pG0 P`M-Ph1p!M0B00`@ ` 6b b` B? 3"0084 0 SR I0 0$1/1/1/1/@- 13/ Ѝ@- 13/ Ѝ0R/00R/0 A0R/Ѳ0 A0R/Ѱ0s@-X1S 4@S 1PS o?0 000010La0 6/PX1$Ѝp@/ЍpM-4M 040U080ܴԄp00@`:/Xg>0L PԤ]ZЍ5 3/ 0H    =EŔ 0445S045\\|SS\0 1\\\Q PQLb bbdb܊bQ1 R?V1!0 P0:0tQ 0000 ep0 0U4URVSQ $13/h14C cA SVBQa`0 S$5(5  3/P`"X0  `1   41S\=pW a@`$1 P3/$1 3/ C$1 3/ 0V0C00 R I` HЍ0 R`t`St1P c S431V2Q,0,$1 3/h1 S c431V2Q0 10$000C0@ 00T0<00`@0 00 00040pC0!Wp!0TR40  S R0 0   \1 R0! 00@0C0`16R ( 45R0C0 S 05 <(00008040 0S*$00e<0(  6/P`]0S01$ 0`P $1 3/ 0T0C0  00C0Vf@0S `b `40S4 `!?o2"6/ $00(00e 0  6/`P' 0S01 00S)@`1  41SR\Z00 RQ 804QJT1Sw 83/`P000$00e@ 0S01 00S 0 0 `1:0 0P D0R01a01 \[0 1V[T 0S0!S  D0 D00B0@ 0@000C080S0Sg 000 10$0 ,00 ,0$13/$1, 3/0 04ST1S  3/`PE`C^`A`A-P0S0R0S0` 0 R@  8q07/U 1 3/A-`P0V0U0S0\@ 08qP7/V 1 3/0@-00 4 ЍA-`P0V0U0S00\@ 08q7/U 1 3/0p@- @8Q5/<13/pM-@M0`1T 8<@D`pP U [  U 0 5/'5S R0 SUP0 0P[UUU [0U 5/P 4ЍMPЍA-`SV P00\@8q07/1 3/0 8Q5/<13/@-004 ЍA-P0S0R0S0` 0 R@  8q07/U 1 3/A-P0S0R0S@8q 0`7/PT13/0p@- P8ap@6/U 13/p@-`1 P ЍM-0MP`p 0 0 00 0R000XPP0 1@0C ? t!0 R b;" W!Q $!02/Ph0;! a, QW Q ! A $ /!. a0, P pPp ೌ!U  R] UPC  P( pWU _`1 450C 001 Y05  JY0 ZI  0 S 10, | 0, 0C 00 0C?o2 0$00(000H;/PP.X, 000000 10$0000$13/$13/  RP$13/0ЍpGWp X0Z0C0 00PPp@-h!l18Q0C3 `@5/0 8Q5/<13/Pppl!h10BQ0@- 8A4/QRA-@@ SP`p 13/@V 13/s@-@`m0P8P5P*41S 3/P 0 0P Ѝp0 0P0@ 0@0 0f`ogZdgM- M4؄ @ 00`t贑중 0RPP" p p000$ RV0   ЍMSV  0  {0 P P Ѝ00 S0 "P   0`F0 00M-ؤܴTԄp@`X $0 E S0* 0MD0 ?0P$ `R 60P4P0 -0P $ PR $0P4PHp@-@P` 0PpVp 0p@ @-@,M`P~41S 3/P" 4p@04 W@0 0H0 00 00pD0 ,Ѝ0 P0@cpW7@-P-@*P 0 P0@ Ѝ0QA-`@Pp  0S`FPVlFӃ 013/ 013/v  `1 U 0U1 013/ w01 3/01 G3/`1  01 G3/01 3/U U0`SU41S\A0ES`@0SU41S\01 p3/01 3/AyAPQA-p0PP``01 @3/0s( v  `1 U /U001 3/ 01F3/ w01 3/01 G3/`1  01 G3/01 3/U< UD 41SL\A0ES` 1PE3U U U U`UUUpUUU41S$\e01 p3/01 3/A01 3/01 A/01 03/01 3/@AU!QRA-@@ SP`p 1@3/V13/M-@4d$(Mt`P0` 0 0P0p0 0 SU8(ЍMP 0 S0$00 0P (ЍX  0$ P HXU0 0 00P 00PE 00 P M-ؤܴTԄp@`X $0 E S0* 0Mj0 e0P$ `R \0P4P0 S0P $ PR J0P4PHM-ؤܴtT@`W 4 0E R02 M.43/0 %0P#$R 0P4P5 3/0 0P $ PR 0P4PpG `M- M0D0t0404P 040@`00@C ` 0V 0Ŕ 0P10 ЍM43/0 P%0 V00V03S  T  T5 3/0S 00`0 Ѝp@-@P` 0PpVp 0p@M-04شT0p4@` 0U 0$R0 ЍMm43/0 dP5 3/0PE ` PЍp@-X1@S` M X1 3/PP pp$13/$1P3/U$13/$1P3/ogM- `p 0Q@   0PSR* 0XM*h1 n PN3Π3 0^8>:W5QQ?W<#Ž0\08:tQ 0U e8URWSQ$13/h!8 b 0RWQP $13/P1S010 0!S 5,5 3/$1P3/U 00PE-4Mp@P `S 0`!,01$000$000000d1 0 0C0P`  0pq0Xd!0P0*`74Ѝ7@-PP @ T@3:P8@PF@ Ѝ0M-p( %@P  BPP@ B`P@T  SU  SV $ {S@@M- M40404 Դ0$T0`@0[4 0E RV 0 Ѝ43/0 0P$R 0P4P43/0 0P u07/$0RP0p 0P4PJw40000K400000 ElpW0Z010 0s0P M-P(M40`1ش00@` p0 ET p@0⛷' 0 80 8/H0 0FpP0 S  01H P0$S ! 000P0  14 (Ѝ0%$0 5 3/$$0 0$ Q  0 ĔPBb 0圢" 1 00 0 0Ĕ R0PW0%0Ŕ 0L PԤ]Z Ѝ43/0 P5 3/0 H0 0   Ŕ=E 0L PpZ Ѝ   43/ 0P5 3/-Ŕ 0 #! 01311S ?0`10`1Q#f?  !g? 1S_ Q{00 002001rV P !("(R@8 QC4 C2 C1  B11 `l! B3 NRh .^B(`VB$B"Ba`    B6 8#8SA00^A0A0A000Ct1 0CS`1l!9`101 P0p!@108!R081P5S! 0S 0S ЍM/ P!S !QC8^C4C2C0000hhf8`ogZdgogNOogb bbM- a@Vp MP`10`1Pd18d1ZPPUPP& ;PT PH P> P4 pP `<P/PP0  $ P54Z zPЍPP P o᪢t`PDPP PP ZФ{̴UTP$@P404`0 )PP $13/X1S+ 1S( 0cP5SMP P UX103 0#UT10C2uR0CuQ0CU0CPC0 P6X1$3/P/QPP{$13/`V$13/0 0 R$1 Q 3/!?xa1#0 0QPU*3/`ogpgpg$pgxf2pg7pg:pgFpgSpgdpgvpgpgXpg\pgpgA-d1 8S5%64@ 5S 5S 5S 5S `1  %R   5S 4S 5S D`1,005P <044$SR% 0@S S S4 4N-05S S44H1S4H1R񟗿bbbhx'hܝbpJh 3hbb@bbbbb\bdbbPbb\blbbbbbb* bb|b8bЊbLbbb@- @6P@N1Sd19d1/@-@0S040S0S0 S0(0030!d1R89d1/1S21S/ 0ˠ  #"- ./Rbhbbbbb 20  0S(S7 (30-@  - 1Sd19d1/0@- 000LA04/Ѝ1S X2Y"4h240T10 Sd19d1/b0! S`10`1d1R89d1/p@-1@SF1SC 0S@ P; 20%2`.0"?0CS#b(bbbbb0RP`0P8500g/#20SfO 30p>m?< =@2;0S(0 S0<0p@pg1Sd19d1/p@-@1Spؘ!Rp0g_0S ?S0240<0fO0 S SfO pfO00p 00pqgR$S"p@-P !@J1S :29"$X0<;"$>="$@"?24/0p/ḏf@B/ḏfq/0/!/0Q$$@-M p40p4hf0`104001(0\1 0$1/tbbA- @P 0Tp` 0T 0T,00,0 0  lP  0p` P  R 0 $@0 0 @$ 0 SfqgagagA-`Pp 0@ 0P 8ČȌ,̌#4 <0 R 1 0,x*+ 0S00S ,< $ <(,Ġ0  0R L T!<$<(!0 0R  f0qgqgVqg~qgqgA-P`p @ @D 0SPp @ @D 0S"Pp @ @D 0S%P p @ @D 0S(@T0lA$0 0 p$p 0 @C$0 0 p$p 0 @C$0 0 p$p 0 @C$0 0 p$pض 0 @C0@T@Tp R@ R    PUᾶ0PUPU RP R000M-@()0P`-0,* +(.0̌/0"$,<M #| $|(#4<pp0Z[ " IЍ0[0*0SP' e@Pm ;@j 0   PP UP P0p! pUPè DL0 0,8#4 <00 0;90P0P  J000+! #" ("$,@ '0P 0[Pp#p3@X H  [@p3p#PX @P zfrg4rgM-0MP@$ (0p 0  0,8#4 <00 0  0,8#4 <00)0(,Č-0* +.0( /0Ġ "$<, #,,#4 <0`0Z= 0PPF 00,0 0,8#4 <000 0,8#4 <00000 S00 0<0 R0<00$0(0 妧80080 0 R PJ u0Ѝ`` P%,R 001P05 0T5,0`VB 0$ Pl\0P  (      T          R  ("$,     , $ ( Bg0 S ,` F F SR 00 00S 0$0p! l) ( $0=P{< 0$ MPr0000 00!FPf(0 0 000000T00V000F 0 00F0 0S 0 0,8#4 <00<00(00 0 0frgP/ 0S @/0A-@`,pPP ~800C800P0PM- 0S  @C   Ѝ@` p pG 0 SH! D"@0sX00 s  !  0 0@ pC  :PP "<<0Ġ"!,, ! "", 0#(#<    0P  [0 00$00 $[frgrgdfM-0M@pPP `0Ѝ0000 0 0 000p000000 0p$0Plݳ ?P ` ?P +Pv `?ijP00000eh/ 0 o`PV bbbpbpbb(00(000000 0`VD(00(0000. 0V5`>0 R . 0I(    Č Ȍ !," "$,X  - 1"=%`t  (48"$<2,S<Z <2Z 0px-  0| `L0 M0PS񟗏b$b,bbbb Z40040R ZP+  XE;0 ;JpP`@ P&+ P%P80,  ,  &;+p 00+ + T 3lP  `;0S Cղ $00$00p  0  $ 0`# 00000 `PZd`0d 0 `0h0d H 0Rh0?D 0H?X 0DN 000` `P*  `0   ,!  RRi  0!0CSWbbbbLb1:S H 0 * 0000 0`Pph;W  hQ d0`,00(J&((0X000hk)`F,0`Fqw$0pSB )  倉 J 0R/l $0S0H) T 0 D 0;8`00 0N 0   $0000 00|( x( J4 (00VR0@0 G`P F,BP  0@rX  L( 4E 0 0C  P#0 0C P"0 0C P!;= P `Jp@[ ( r0' mj rX   0A rX   0A rX   0AQ0S0S R0SP0SH' 6A\(' <0Q'  BR& ;?P& t,⻤P)  @Q R&  D0R d&   0P&%%H0R & h;Q0%0  0R S % S % t 0Rڔ% XꀤP0[ l%  00UX 0R <%  p80S p% jNP pK,IP $0  HPP` 0$ V`3  0S00Q t$ 0`$ Y%p3#a00)0(,-0*Č+.0Ȍ/0!<# ́#4<`0VS H# Y  Č  Ġ !0 S T# 0D0Q 0#   Č Ġ ! 0 S " Č Ġ !0 S " x0 ,!  S @" ,᪣PNZ ᤣB4!0 Č (Ġ "$ , S !  0 ("$, S t! hh pP h;X[PU H`,UPJ 0@0`a`Phhfsg]sgsgsgftgttgtgg ugMug]vggfffjfzvgvgJgpEgvgugug"vgvgwg}wg{gwg~wgwgxg>xg]xgh{gxgxgxgyg@ygqygygygzg.zgOzgozgzgzgzgzg{gf?{ghhP H 0 0C PI0 0C PG0 0C PE0 0C$ PC㠰堠`h;VAwX!00S Cn0k0 h;p+0Ct;$0x;H0h2X0l2`P`P`P  l`  0 0C  0 0C  0 0C  0 0C0S 0 ` `M`K0S" ᜢpP. `Jpp@-@0`PX2SpQ  P0@-\M@P o   \Ѝ0@-\M @c P0p`X2S\ЍQ  q P`0P82082/h820C82/p@-Xb@1QQX2Sp0`ԮҮM- SM #SPp Q K<0<@S ' `  R0S<0' t`Ѝw p0S p WP' P0b`W1S ' $Wヿ@P ` 0T202崋 p[< E+P0S & =` n lj;S0l; $0SQ c C031<2 h;  0S- ;0;0PP0$ RB 5R bP B3Q u 00bRoS/  U``Fe Bep 2 U`Pbk0S;0;P[0U;ሻ  E @% D00¾0P⸾ Uᰫ'Z% 0J 0 0/0?0k0Q ;;;; 0A;;˔@Pe 8$ @ 0P $ , 0Q?SQl˔@LP # h;LS#0ӓR?N1c[;0#;%˄0 < l0;l 㗾P `P `,#<0 \YTz< 14+<0R05 `DQ`? PP "  05`c`0PP "  0< 0 0t d0 $ \ 000X2V&"PP  0D; s#0P-=!  0"Q " PP 0!P!  0``;d+#:6B*0 80< l+;0dB5 ;0P;+ ;08;+ x;0 p;t+ 0 X20 B 0<20:0l2h" H20D" @20H;q 0 A`! `Vh{gtf|gb|g|g |gf|g}g{}g;}g}ggfff}g)~gf\~g~g~g~g`gxfg+gggg2gnggg?gPs@-Ѝp`@P 820CS82 Q 0 $0X0P Q; < hLg!]`v  r p; < 7fghӁggM-X0 SL (@Ѝb,PD 5!@Pap K00v@nL`P<p0S _0 CoRP v pP XTPW @0S j@ @igphth~g^g5ghp@-DP@0S U@ T 00 phphi @-xQ!M-XMp`Pp R Q XЍ@2@P@ Pi W0@@0T币 S0@0Dp@ G@T[pL`lA Z+   p00Z0S  d0D00KS S0 GS UL0C# D MSL0C#PDX H  PX @  zPT000DL0G$0@0igւg֨g gth0gXgg7@-X2 14P\20`2@ P\20 `2 Ѝ0M-pM@ X2 S 0P㬀X20CS>0 0(<"$0,` Pd h 0l T X 0\ 0 0 Č  ,Ġ !  P  0"  ЍX P@&$(&d%,l, %T\PzJ P  Q Rt+ B QRpU0 ! }00!  0v R0 CR]0S\t+R 0p! |d 0+T TX%XUM0SL P 0⬠H0H@ `X"Rᬀ PO !$$( "(!RAoQ  0y 0P0| 0` % }zi`@000000 0 0mfgigg$g_gM-`p  0+@Pt ;@q  pP D Ѝ0000000000000000 0 0 0 0 0 (<  0P0T0#,, Ġ  P0T #8 (), !-0!"8",*+.0/  0P\20 ; P 0 ũ{Z 0  $0 p@-@R@P` r <$<(0#( 0#< 0`  <J;@ `YP 0 ,X 0$ $$S pif܄gegagagM-88  < k ;(pS @" 0A⬀2#a0X"\2`P-@0S" \RPP P`R V ;`X2V0  `P0 `PY 8PU4' 0PЍ0S' 0,0 0刜PP \`0a0 1 EQ \20; JpP0`00 PyP Uq PrkX 0 `Pi \"P u`Rt;x+`b0C D2X2Xi̹PP` 0<00`@0 0 X``0d@;;D0<0H0L0\+(` B85$0X214P00<`000 @D2`V 0%0 ox;S $ h@2X"0@2D20CD280S  $ VX$ O`倨 DB P0<`P ,;mP `0 0,8#4 < ~ TPP 0 0,8#4 <0<00 0,8#4 <0X0 0  0(<"$0,0\0!  !! dR  @  !$$("(` 0AD0:`0 0d $01010 T2s x" P``0pX2S`T40Q00000@0<S @ D0HL0PT `=P 0S  S101DH00C,P T0 P T0L0a<0SRx``0P! `|XP P `X2VPk<0SP  `P  S S @ Q S \0R 0  FCx0000 PoiV/fgIgggf!g^ggffgԅg gچgf*g@-@Q@NM-;@PЍ<0SXQ\[`Zl$ h ꐋ/o"Q R <$ <+ B QR $  0b 0[ ? # # 0@  BR# !  R# t+Sh# D0 HX ?0<# XZ$# 0@d <`\ P 00" D0@H/^ # " < P " LP l" ~PT0RQ H" |u 0" hoP<PLPPTQQ 0 X `0 $08$(#4< 0 4  (48"$0,0  $$ 0X0X(Q"( ! P(\ 0S110\ S00^0S ePPX2U pU`*! 0 !44`8V<#,,#4 < 4 x$ 00`ЍMDfwgƇgg"ggxgQgggg gDgogggӉgg`gM-0p匫t0Zx0M|`P@P- 0101wX0 0 40S00- $ 0ݥP 0Q`$ `P  $(`B(Q d 0̼ 0P# X" R 04 含8 JD 0  0 0 04 8 o BD"@" @" <Qcq` !6&,, &   P8Z! 0 B    0wP/ 00 R@" @"D" BD"d[+q@0<`SD0H`L0PT   { 1 1Z@" B@"D" D" ꖿfg>g^g$0@- 0@0@0@ c$0 000/@-@P$`2M` 1!p d600@0S1TP0PPD1P``0QH0D00LH0L0$ 101Ѝ ၴM- @` @0$pSP;pC p0cp G5 0P$00 0 0MD  B50 $p ME-1@01M` pၴP P, 1 <0 S(0. PP 0zPPi101$P` ! 50  0101PP Ѝ PPD?P0 0 %0 00Pp/ M-p;SP%0 00@DaP0 / QpAUP' D``FV` P PЍ³PD0PU, 0 0/RS$ 0 0/PG0 U$ 0RP  ,PP/ PP101ѢP00P 1 PP D`U` ᵳPD0S 0 0/RS 0 0/PE0 00` 1 P P 00;0;0; 0;0;0/P @-@P /$000@- 00<00EA@001#10 0110$0X0(0D0,0`000d040130  @- 0 B @R5c,5c<5cH5c,  B, (  B( H@`0  B0 4 8 PE-p0BSlpD`PP1 W`X2W]"PPZ 14@TF X$ X1 X40 S,00,0 @9S00S000(00(01 `PP Ѝ40S00S,0S80S040 80S40S080V101101@֡@p, ( 0ᙽP@ @Pf|gM-`Q@@PTPP0p@QpX2S@`0Sd᥸P X@@-@ $ \1XR\Ϝ+H Q(P&JD`PU"@`VL QL U^Ѝp$@0 P Jp@0S10100 S @0S R<0S1}///Q0 < R!1///np 0S0 ///၀P/ 0S0S/p@-Px00CS0p@♓p@A-`pPP+ 00 p x@P0 000 t 0W 0@`VP`P@P00X @A-;$S@p`P@P!1S@ Z@ ЍM-M0$0@p@` 0PP 1[  < 2Ѝ@0SN W8 ~ PZ ; W 0   PP P0@SI;S0; Be  R P!0P #"08#4 <0BP0L< ; 8 0 GP Z Jz@ RIpW dPpW U 1 W P< 0S깋gM- M0;$S`@ `P1 1 0SD ; @ 0 PP u; 5 X:X"1001400pP ;p 00EP PGן;`S0;i  0 嘻 0 PPP PP00 0f Gෟp"tt"<<p„0Ġ  "( (),0!- !#(#<*+.  /0 PP=$ 00@0D 1@0S%@0 D 100 ;^PP" Gt01 00 0 3 T Ѝ@00 ;]PPP 00 000S0 e Pk <PP ;P ( `00p"tt"<<0"(p„,0- #(#<. /0$(<(<0((0 #(#< 0 $*<( <0*( 0 #(#< Ġ02  X()`!!+* `\ "<<0"(0 #(#<00 0PpP `E y 0 `PD0S 1 q  E˞fD ; @ 0 P `v;;S0;00 0Y`P 00S 0 p"tt"<<p„0Ġ  "( (),0!- !#(#<*+. /0 RՋgg)g;gM-M0;8S<$p 0KS;` C 0c0P 0b@P ;@  ]P DX~p•tt,,  ,p  ()!!+, "",./ ',, ' "",  &,, & "", x" 0W,Ƞ*-\ "<<0"(0 #(#< 0 0$0(<<(0#(0#< 0 $+< <(0#(0#< 0+( <$<(0#(  0#xgJgjgggˎgggogs@-;Ѝp0`@ 0(<"$,00l PS  `X T H 0DS P  0!IBUf^gލgs@-K@ l;`!P `@P` 0Ѝpfgp@-;@pP`@P  0̴T@fލgM-p(M`H@P0P0 00l?!԰0$00p0  嬹0P% Js  us  ឴0(Ѝ Z$  \ `PT 0却$ 0 R Js R0+ ߏgggfg@-`p 㣩@P P2 @0 00PP00J  P < V = <?> ̌("$, P0 T PGD 0@B Pq Ѝ Pffkgލg@-@{ W ` \'p Ѝ; l;`!ॺPP P 0pfgĐgE-P@ p0`;PP00J  @0 0,8#4 <0!S Jp@ Ѝ d P T@@X  @<  =0< >$?0 Ȃ< $(,Ġ0 0P X  TP $  0ᰳ@T@#IBUfgA-pP; 0E;`PP00J  @0 0,8#4 <0!S Jp@Ѝ@  P T@@X  @< c =0< >$?0 Ȃ< $(,Ġ0 0P X  T/P $  0I@T@!IBUfgE-P;M l{@`dP ! .pЍ  ? 'P #Pupp 0 0`0  F  Pp 0P`l T  0X 0 H0@ 0Pup"9f&gbggލgggM-p; MS@P #ٲ@ Ѝ`@P0 @P;W ; ] # 0ὲ@; ;@P;  ݧP ; 0;PP00J  @ Jʖ< =0<> ?0(<"$0,0P " 0||" 0xw @Jॖ ?@ JT 0l+ǿ000 0 噷@Pf;l 0P0 ! HlK @Tk 0@e0000 0* 6Pup00 _ @P0 0R 00@0XOH[〰0  p  ` 0 0  `傮 0 000 `t0 00( T0 p @|fgzgf-gލgfgg-gPggggU0A-0B00I00#0@0+p"<<0"(0 #(#<0 +`"<<0"(0 #(#<0 <""<<0"(0 #(#< 0<  <$<(0#( <0#<=>  ?04PP  PP;0 0PЍs@-;P`@.U00B00I00!000< 0Y <$<(0#( <0#<=>  ?0"Ph P ;0 ;DXP Ѝp@-{TMWP`  .@TЍp@ 'l;  0 / 0$ @0@P W@| 0xD0SWP T0@ l;@P;  0xfg g:g`gE-M@`p PP;S " ްPЍ+ l+R 00@PS70X 0@PS ; ? P-Wy  ᰰqqPPcl;0 0PPZl+  P! 0ᕰ000000 0˵P L! 0D傰l;  Pl+ &l;0 0PP'l+ &l;0 0PPl+ P` 0TZ | MPPPPgJuU0 @0U\Pfgϔgrg fg_fg.gfggp@-^@P`8Qp 0  0``3/@;0C@;>p@-80QPp @0  @;0C@;03/PP  0fg@-(;1S + p  ^ X R D 0<߯ ЍS   fgp@-P@`d 0@0S Rp2Sp2Sp0?Sp ^  0 0S00 \   \Q/ 0R ^QR 0R-/;/s@-@P`P` 00 0  aЍpf\gp@-n `*@ P:0C:p 0wp@-P@Tp@T@T0S@0S000( 7@-^8;PU ;@SH;S ; Ѝ0P -=  08;U5fgA-@p `P0P T0000 p`P><+0<˄0 @;0@; rc$;S6A-:@SP 0 $;P$ :S :S ~e* ` 00C S00@00.<; < @;U0@;/xcM- `(M000 00$00R@0 ͒( LP00;  T 㻣PP8 0 uPPF 0  0  0(0"$<,#|$|(#4<pp?Z W& W0R0!0# W p# pRᄒP`#0PX I{ Rs( ;PS0;ul epP`  APPK ??Z :0"0  *< $( <0  0#(*#< 0 8PP% h2Zh5~2 L:0:;"PV?0`;V/ !P  S00;(ЍM 0 (PU ` Pt1S20 0 $0P(Ѝ( tuz; 0!崭qH2S D2S 婭0CD200 塭lP 0SD20D2UH2S 0CRD"H2 0D"0p;0p;t;0Ct;0SH"R 0yfލgԖgf@gqfgsggggA-@p `PᓢP  p`P A M-@M 兑0S {P! ; :S *:RSJ 0H$;lSBP̄`pP 0 0C S v:0: 00,k0{0 hPPP, P P  00x#0 p0 00000D# 0@O+]Pቄ`pP  oᭃ0 0 $ 08$(#4<  0$08$(#4< 0jPP* 0ES$`|czc|c|c|c|c|;+SJ(" ,孬{ 0  0!0᢬ 0H0;,;$;4;ΐ( M&U0S 00  0ቬ Hຐ4[Up00;,;$;4; 0 0PP W ( "WPP|;0|; 00;,;$;H00 0 PP ;S0;UPЍ ;0S 0CV?*01j0 `0S000+y Pf%ggeg՘ggM-p(;@Q,;S 0;S0`4;H vnP  ̂(00 0`P1 F-[P +m` sNP ` g᥂|;0C|;0(0`P 0$  ʫ;S0;ЍfSgA- @p 庫(;,aX2 PP-P&0;S P ^P 'e+APP 0, (别;S0;PvgfSgA-~@P`p80u  Rv 0  @;0C@;03/P  R 0QM-0::::H0h2>0 8;<;@- ` 'h nP P( +}.0 000S0;:Ph  H 0 S% PH PE 0 SGḂPP] $ E,Ⲃ`PR Y F0P$    (10TᮂDP 00 (+00  P ( P( F 0P CP 000 0 :0:(;  P PEmPP E2S0D2S 尪x;S t p婪!(0!"Q0CD2@20@2PPЍ蜙gphSgf^gA-@[P`pQp0PU741.( A裎 0 ( p  p@-@:S@;S @! <W`p9`P:S@;Sn `ށP 00C SZ*fPU /;0S 0CV?*01Z0 P+l;0C`P` 08 < ؀:0C:꼿frgOfg0@- R00 R0#01 #0RR@ P0 01U 4## 01 4##  R0  00#01Q #0 f BR0S ; 0c/M-4`@0S@pDPP @0CSL0D0  02@P Jt@ ӍЍPH0S@HL" BR/D2S/S 0CD2@20H@2 傩gP2p+0C?L2/0S/\0 /E-plMP@ᖞ`P   ? *`@ ]Pup0  PT PO၍Ѝ0 P0 E0 0@`Zfbggg@-@40 $08$(#4<%" 0  Č  0Ȍ$<(0!, ,Ġ !   000 $08$(#4<0 $08$(#4<0 $08$(#4<ר=0< ?$>08$(#4<PȨLƨ0@   0@,@ЍOgkgggggԚgggg@-@孨0 $08$(#4<H垨@囨8嘨0啨(咨 0 $ 08$(#4<僨 0 $08$(#4<t0 $08$(#4<e0 $08$(#4<HV0 $08$(#4<G)0- (,*Č. +0/Ȍ$<(0!, ,Ġ !   0)=0< ?$>08$(#4<d`0@   0@@咤Ѝg>gOg^gmg|gggggǛg֛gggg7@-@$<X\@`DH%ߧLܧ!קҧΧ`Q dPY`0Pl Ѝ0@迧h00g00Pf0e d嶧 Ѝ0g5gJg_gtggggȜgݜgg gg3gHg]gs@- 0@4#TTᛧ0 $08$(#4<\匧0 $08$(#4<$} 0 $ 08$(#4<nX j%X fc0SЍp@\U`PQ0 $08$(#4<TЍp@@000080 7ꄝgJg_gtgggggHgg]g@-@d'\$T!LD <4,$@ѝgg gg1gEgYgmggp@-@PPD<Up ,$!p@ꕞgg˞gٞggg/////p@-`ᱢ0 @00P0S R0#R XX˦ 20<0 0 0p(,0C000p'fg?gA-`Pᄢ@  U|p T`\00`PF0H40@ S  卦0fgfgA-`*SLp@lP0 0pL 0P0 00p !0h `,0X 0 $4 ᯔP $ 0,ꡟggƟgKgR`gfp@-`P@ 㱍P  㫍P 㥍P  㟍P 006wPP `NLJ p80,04000  (@4P)wpҟgcc0 R/4000S/p@-<8P@0p5P` mp gp@-@(0QT0pQP ||ѥ pTdd PJHCD0D @ R$0庥  pgif*g 'Pgp@-@(0QTa0`pQPPP圥pT48啥 pPJH@C0@˿frgg @-X?0 2z x<40<4L40L40`4d4h4l4 04#$$0(8 <"( 0 4$40  &01#36/A-`|@  @0Pp R 0 0`d1h4 8l4 0< @202,888C2<2\ 20 0,0202 0D H2 02 888C 2 <20P220020*666p 6!*t0@Sutt0<4041707t<48 8<4<40<4t 0 606,@ T 84p#8v0 v0 @P00@0@$8gp@-PZ@რ;p0 /1i00S 0  /i1i0 /1ip@-@e`0S Ppzh0dz\0Pt H <0 0 "ppppififi@-ePx@P, sjzP) m:㵟P ͤ0@0|^P \0`VP 㹤@0 P000giiiggip@-hP00`@`0 R L000@ \?C"0C" B 0%p iiiii@-`@PP   ۟PPP 0 ``0@@0PP ЍP%P0 S P 00P0p? x0x x@P0 <U D00 S Ѝ@趬QP Ѝ@Ylgiiiiitiiii7@-(@PUP Ѝ0i( (0@-0 0/@Pai ip@-dP0S pP`0S돬@P4 0 00叱@PppiiiA-T`0S0P0Ԟ@T@ Tp|Y@DPi7@-@0S哮0 Ѝ0@衮|| )Pl呮h0P婯`0 00D D0D0 夰 Ѝ0iciclgi̚ctiiiii0A-`?o2P0S 0Qp@ TvPp0\d0U@P! TLD"0 S1:d,E< , 000iiiii-TMP  _L00<0(08000404000@0 (0<0PTЍgcccМc c/A-PP`pႇ@PU Ḣ@P -0 000 $ 40 0C08`DpHPS00 ( , 0 0S 3/P dd厢  " 80@ V00W0S`Ag gshLshshsh{f2gZZA-@,0P`p8/P Ƞ0, 8/P0 00M-`p(MPU"!0@ 0T3PUxVX  F(00^B$0B"0B!000Cc E(00PB$0B"0B!00 C 0P.R 0D8PC4C2C1A 0P P 2s 00  p 0AP (Ѝ蔔fp@-40@SP 3/Hp@v:00S //00S //P -,^ 0 8//M- P0S 940S/ `- 0@嗡pĀ @ 呡00&QV务m@OP ׃@ Qw  `@ HgcgPgxggp@- @40S=,0 00` 0  _   1  /  00p x Ps0  d   00|00 S c  ? 0@ W 00 40@0?  d00@-@XP@@-P 0@T 00 84/Ѝ@- @+ P00@< p@-40@S 0<0@00S = dS"<< R<8p@#8 (`,0 `(`Pp> 0@00< ; ;@0 0P- 8#8 PPp Pp  Pp, <0 < <P8#8 PPpU p@P Pp  Ppp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0epp@-L@@ p9 P7P  sD`@  `V0~p e@P㖜g@-@q@s@-@P` 0SS  08  P$`Ѝp象gA-@Q`pPP   g8p@-#8@` P8#8 98#8p@  QRp@-,PU 0p@/PH@0 ^ p@ p QRA-`0pW A/`PP0@0 0S0 A0 D00/D00/D0$0/D0(0/D00/D0 0/0@-P0P/gi/ 0 , /i0p@-|P@x`PMTPЍpP  `00@000<04080@0 00D@(P,`<0匇,@i@cLcXchcxcc<0p@-@PTplP,@0@pii@-@-0<0@0/@-@0/Rp@-3  pPz @P 0 PK P   P  P P Rhp PLV@<R& PJО$g@gPFg@-O@0/@-J@ 0/@-@D$0@/@-@=(0@/40@-00(0 $$GJ! 00@-00$0$ 4@ C! T @-J  P@-@ <@8 @-@@P/VhVh 0 0 00A0 /@-t0@ 0000  q 0/p@-P0000p@0  /0 //@-0Sp@-P @LP 㢠pfg0<00S @-@3/%/@- R  /0@-hPM0U 0T0S $ @P 0S u㇞P 0S h0 uNP 0 PƛP (P Ѝ0vg@-餙0@0 00Q00;0000/0s/A-@ᕙpỚ`ᄙP!P V80 40000 ,000 @x}! 0<00S /%/0<00S /%/0<00S /%/p@-"`0#" 04 P2$0#" 02#T gp@BҢgM- 0}>CcS@Xp ǀP P B"ǀ$ , 0C28?8 70A20 1PE\TP 0`Bbd!0C2?0ld`᜵7!0A2880P0g@-@ỗ 0  # ,##Ġ ,##Ƞ ,#<00C"  00<#"Ơ 0"4 0<#0":"(0 #" }. gp@-Pთ@Kpp@-Pᅗ@LPD J< p0 00LAp0 00pxggA-P@,@D,0SD0,@p4<`<`F<0S D0ם<0<`C00@-  P@TL P@TD P@T< P@T4: @T.  @T(@ @T",^P   \  \   \  0@o0000 0<0(0S /%/ 0?o20/i@-0 <@T% @0 4/ЍM-0y `< 0@ 0娛[% 00P 0 @;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-x@PL0Pp0,PE, 0RxP001 81jS S> S0`1@  04#$R R RB `㿑 0T U PUPTU  Y ЍB'0`@`0`0Sul"Ah"`0 4 0`@  000000000000 000 00003/P 0P0000`       0001S8000R*0 88(0000000:00 Ɣ`*00 $R R R R.0R R1 810000 0:0 0 0 8PЍM##tVh#ffgM-$P@p`cUVW00P0S@P<0U0   20202020000S200S|200Sp200S Xp`AP000 0(2 KPP9kx03/U1Si00j ``  0 0 :p$0P@00p4p80 0``  ppp 0S}{PF 0P P0 S 0 00    $  "$   $  "$ 0000 0 00@00 @000hC0!( !Pœy3/PP 0  PTcHcclcgtVhЦg@-郏0S 1 1  'PE-@rPp  ːP 1! 1a|``P !8:8:8000 0 Ѝ 2~6.0`0SxថPl  d0 3$0 R0C0 4 200 00p0 Pgicg!M-`Q5 p0S1 ᤎ P0S( 0 @DT#@ 0R rP0=S P@D R ! T:  HЍ@*g@-@@\T@-M @RTЍf$0P  g@-0(M@ 0T 0 0 0 (0 6P(Ѝ PVh7@-P@P ?0S Ѝ0@-@h0  0 0 0 0 00@-MP@P ⁒SЍ0Zgp@-P@P ᎒p^gp@-P@P  p@p@-P 0YPTP1S@-@o耧g 0 @-Pg@-@P pU0Kd dd 000@嫄PH0HЍ@Ct   ) Ѝ芧g'gVhTi@g@-+0   0凄Ѝg'VhQp@-PM`   0P |)Ѝp@PX \0 @@@aPP 000(0( gVhTigg@-@Mhp`P0\ @@p`唃P808֑Ѝ ὆VhTiAg$Qe긧gM- MD@p[` 0$SU0{S` SO`P[00@P 01 ՁPP1  ȀU [00 @001 Ѝ000CS  00S0[p@0 t 儌 pH0  [0H 000r00p@Vheg+TgggQ/@- P 0000C,0PRrhrhrhA-p`P@P_@,P(0 2 '03/@P$!,`*tuP`gf@-,@P ` 0ST ( !<@3/@P =gZgg0gfA-`@pPP V@ tl @ $ 0S 3/@P(01(0(01(0t $0`S@gM-Mp`@' 00M ᜐ #KNP5 (010 P pM 0 #KhP tV [uP ᤋtPuPP ᘋРKtP Р  yhgmgM-PPpP ,ʋ`P)ы0P8 &u@P Pm:ḋPP 00䷅PᴅḋP  7/PPytVPPV ptPt@P I0 0bt`tRP0@-0M0@ PH 0@P 0S@ $ FtDtЍ0\cP@- 0\ X\8@0Q P D1f0 /p@-4P@00I $m ipcVhcgp@-@?P ,P.P @p ɏpgبgp@-@+P ,PP @p 嵏pg gp@-P@0p8f0@-0,Mx 0 0 0 (0 @0S T0 ,Ѝ0P P Vh7@-@P0 m0S  S 0R XR U :P@PEP` Ѝ00A-需000PS`p@PP tbPP\ P Ѝ P⣊P  ټfVhiIggM-PRM`p@0QtBd2Q@Uq 000CS"4c\ccdccc0 00S /0 0 R& S00S00XS 0GUG UM UA= C01SyS tSXS0S F0C0S@!  8180 ΎЍY0C!023 00 0 S [  .RKR)P0 0   d@ +,@ P@ 8华 ɉP ggAgPg ggͩg0/A-pPD D00CQ`,@UچᩉP`drhrhdrhp@-4P@00征 $ p8cVhxcg@-0(M 0 0 0 0 (0 @~0S T0  (ЍᚉP P  0VhA-PM⨀`@ P0pS *P0P0` P ܍ P iP P00Vhigg$/E-MDM㏚PP+ ?pX018#@pH`$0* 0RP@00  0 #P0@`VT3:V+؍DЍ ]&gM-M8M7@PQ@P@؍8Ѝ复@P圍=`P! 8Z 018#Xp$0+ 00P P     ’P0 PpWU3:W  @o@gEgfTgf7g///// /80 P D P R//D/Vh///E-gM` 1Q弁p3/@P W0\ 000 U00Sl P⒃ VV  @gߍfg///0E-`0 0p~PP@xxpV 0SSP0S 03/P40 ,0P ЍpWD@hiiVh idiA-`QPx |P@hp`P`P 03/P H0 @0@`|@TDP@ihiVh idi@-@W$03/00 i(0@-L03/@ i(0@-?03/@ i(0@-@203/@ iA-PD0@#b000 0``6/@Ѝ ip07@-P@@,03/PU 80PeP Ѝ0$0 0 000 iTihidi@-@i<0003/@T0@d@Ѝ iTi@-@PQ0403/@r iE-PP"0` Ѝ0Sx `@PX  S p `pTigȫgggR7@-@ P@P @ Ѝ0 SPGfM-`0BS0M@0ЍRP @P ы@[B C0 RP 0S[= [pB 1[p;*  p1F 00`0UP   0 `6/ه[`勋PU PPp m "rV m$0 ,00((( ?,\ !TmPmHT @Qs(Eg igffg*gDg:g4gpEg>gGfp@-@0BSRP !PU }Ppppf@-@ P@y/pi00_?SP/Hoi7@-PPP p@0 _P TP _ Ѝ00 e_ibg@- o Ѝ@-@#P600S%/i K@-@o@M-`M00 00$03D0`0 00 0 b0808 0@0PTS(0 0 $ 0 V00 0V 000$0 0S$0000U0S T`Ѝ 0 $ 0 0/0S L ( H032 HrH0,00L0(0H;3<000<0H0 HbH?400 0p00@ , Z:s 0 @P 0 $ T z0(0@T c=@P80C,0 C R0P  R B   L H*< H L L H04 RQ `K B` T. s$  R  p @Q  0`E0000000400400HD0~D00 QP_ p 0W3`0@s 0 @@PL 00C 0B ES R@piHP <P 0@-MB( @Ѝ0/iiE-M@8j02[p0S$0K` 0,@K0  0 @.Pu2[St npggggggM-0M@`0 40 H(@ 00M0,0 @P P0/S S00@q /#P0 ,0(`S PC 0/R ,0K( KPKp ,0(PS<p!00S0|0S P   8 m8 pW  ;R*,ᒀ0[0/SU0`_o,0K( KPiU EX 0S0 (004 ,00$0K 00 pP$0 0xiii@-@00X0 PЍ0KP TPTPi@-`P0Q0 xp 0_0P @0S 00@ Ѝ P_iip@-@ T1:P il+@hT' S`P #0RL0S0 0 5 0`0? 01-P|ARx![P @ph00piSp@-@PH0@D0DP CD0`46 f1 F525V(pii@-P`p@0 DE Ѝip@-@s[D`0U p@, 0S/P/ 0001f0H P/( @-@ {T8iiQA-@0P S S4<1Q=4R2Q*0!ẜ`@0S \@ P`0S& S! S0   Q* Sq4`ADq,`p@D00@gM-QM`@!02*P% & 1HРpp!RРT'K0  0 eP Р!1 `@DQ p NP!`@D! p  & !1GРPP  8P Р \Р1A-0S@p@ `kPP  P@g@ :1 S@@ 0$@00/0@ S P~@P@@d<~P 0 , ~P0@08i&g/g8gE-dM `@ pP) PD00 34 0304S(0@0(0(08!S0(000+P,0开ᑃ(,0 TU-0Q1 S*pdЍQ( Pム 0H0L0 201,0 H $0000 {jP @$000$0 000iAgtggH-000 0M`@T @ dP 0P0K H~PP8 6~P $ R~P 8iiƯgYgYgA-0S ` pQ 0Q@%  Q"  0BUP!m &P0100 S 0 S  1 S:00P 00 S2 S0>P@-0@SP 020C00SЍ0C00 00M-0P<1@P(@Ѝ0 0 0(0$ Q %  R@ p @p@ ,pWO*0SS00  D ,0#0 0P0/o"X R,0<1K 0410p  0 G0 .0`0  0 p00p0` ,1S,! S0,1<1S< `0P `VQ ` V Q  Q ` `[o } 0  nE@Pc M-@PpK0`SP \S/S }P P0S /S\S0S  ERH|P0$  $0000000SR EP <|<[1 ! [|P <1S R|P 0 1 P! (0S00 00$00 0$000000000Scg,Tg@-@pM0S v|/0t+o 0|@P L!@pЍ  & @+@8iɯgܯgPgggp@-\0M` ~h@P PP DP,e*eo0Ѝp@A-0Mp bhPP @ `P@ 'P00 e v@P  @P0@Hdd0Ѝ@M-PM @ pPtxp`.h0P0 00Q P0P0J 0P0A0$0 Q A108V .UPU P@ 0P?0V0"0 0U PQ`V000`  U  00g0P 00 ddPЍ h"P@\S$0 S2 S0>T*0P0  090P : ldPU  S0  `d0 00 00 0P@$0 S2 S\1>T*`[ 0 P0 0 0   @Z 0 P P$ R" 0R .P*0 00`  0 0 PU   0kP@u$0 S2 S0>Tl*`@g,gA-p` d,gPP @ P (bK@P @PP ccp@-@` P;P - z! 0000 !`pp@-@c@c/0@-lMP (@P0000 0HlЍ0Cgp@-M , RR:ۍp@@PˍA`Ud @T @`@T` `  @U@`0M-00 4#ĠČ ȠĠP,Ƞ@8PPR&*p@P0.8S 0 @ ` 0 S0P#4S03 [0F`P @V `PЍ7@-  P@@@dQ@ Ѝ00 <`M-@ Az` PpV Ѝ@~  0$(,R2 R/(  zP( $(,R:0Z0R0S ll~ d 0~XX ~ 0P4 8  T X \`Ugg ggggE-0M@ 0/R `y/ypP  @P&l~PG  {y< PQBy@P<P 02Et@P88N~,K~( H~ߍ00P깰g ggp@- @PT  Q:b@P 00ll,~h`)~p 0  @  0R0@00Pհg ggp@- @TpP P 7bp@4bP2bPP.b P: SM-b0@P - Sc0  Sd0  Sf0?0`ᬀ 0pJXp0-00FV  @s0S00  s0S00  T0t0 00 0 Sl0  Ss0  S-0gM-0M 0/R `xP01/ypP 0S7  PP1}@G  x= @BBx@P=@ 03DPP1S w}t}q}Pݍ00@0Z U`}]}Z}0U`|S} 04 8 <  @ Xh<C}TV  ( Rx0@ =0C%0$pt&0x'0|hp 0w44 0p4 8 < s$opQpXd dQ ^o1PHS Q@% !|Kd EQ ?oD1J80! X=$0 0 0 000 0 p0 | x P00w,P00 =0T 0|0 S P|504 p$60(70,D0| || H깰g ggUgQf`fgzgg'g6gg 0S/p R p@-8`@TpP U|0 4S@UgM-0MpP+ 0$00( &V 00($`P  $  0 0`}^0 S T`| ` 0 q(`|(0P S<#U* r 0 Vl#P0E0(  U *Ud0{0@PP000 QQ`BDV0D`#{0 E@q#(  R,#!R ! AJ@P@:S0( 0 `BDVD`#T t{0 ~0 4@$S @0(42 0 4:2 04 8 <$0 04 8 < (0Ep(0P0( 000 0S0:@ h3PW 0CP 0P  08h{J03PI 0P0DS*`BDVD`#X{@A @04B 8C << 0p0S* 0P t_.;{0Ѝ000 04 8 < 0 04 8 <0 04 8 <[10g(0 0P* BR`1`!{@! 04" 8# < 0o0S% $0(4& 8' < 0o0Sd^Q@<] P 000 04 8 < 0 04 8 <0 04 8 <[1000 Q z 04 8 < SR00 $(L@@@ Q 4z;gg gUgQg ıggqgwgg@-@4CP Pzaf#g gM-BM@,pP  0P0nzBߍ`P [ Rd^ U`@0 VTxTz0`d0h0lZpLV @0 Az0 48<R 1048<S(:00R00S #z (0z z0P T0`X0 \ 0000d0h0l[ @y 04 8 <S5 40D46 87 ,t5 4046 87 0D?00042 83 ,Sn[0S -0,8 Č.0DȌ/0̌ RH@FdGdGdxHdxHdGd4Hd5404687< BS 5 40146 780 <$2 (3,5 40146 780 <$2 (3,[5 40146 780 <$2 (3,Z{0(;y(fMg gUggggjgggвgA- `MP P0  R 0p` W`p@000 y@T`Ѝ@y80S` #"0T  T 10 $2(3,P P 54 $6(7,L L pqgUgfg BR/ 00@-P@\^@ P@R000@- PA\ \  0 0C0@^\Π@ 0P@ 0 \000M-n3} P`p @PT@ 00 0 TBT@D T@ ADAA 0@D@A P[K 0 10 0a0 00 CTTP [  0 @- 0Q0 R0 R! B!0A  !0 !R  @A100@- 5 2@ .M-0M<00!C 0/S0!@0 T00 u @`Tq 0Sn P/ 0q@P0i0j`ljpjWVP[[ uꇳgggfegE-M<8p\@ ,10%0uPЍQ 0S  %\`=`P00000S P 05/PP00 P00`00`0%Lju00 P0000`0%]uCfg@igf0gM-@0 Mp0`0200 `M!PP u* *  Ѝ)0(`d*0h+0l0F S*0 $0(0,:0-,00 B40000 0jPP P P *`00,000%u%Pꤾfg@-$VPRP@MXhWhXhP@-/o`/M-$pM0@0  0Ҷ 0[@P@ 0iPli`iVUpp PtXX @ 0匶pЍ\\tUV X0S @f 00` `0 08@0!0(pD 0Lp000801<0u" p@0P20p( 18 LD 8<0b" p@0p20(@203 4H080(0)0(p,t*0x+0|-0.0/010S S SNt0% p$  0AtsXqX@nX$08ptᩌpQz}Hi,ឌp<a<0ᖌ4㒌pQpX d ᆌQ ဌo1SH긡帱Jd pQ jo1Jt0!0 X/4 0  ,  @!008!Pp  s$0"s(s0800<0(0D 8L0! p@ (W02000EH 0t  00@0%|sb(W0 (00!ZWPifegдg״gܴg޴gfgQff0@o//T@-@P0P a^p PP4S046 Ѝ 0060 0 PPS `0 @ ``Sp0%ofg,0@-d@P P Li@- Ѝp@-@P`0dUS0d0pSd0c00SPp@-@P VPp P@Hx00x| H00T0p@-|xx x | SL0A-`@p R @@T V-PQPi 0S/0 00!000!/Q0 R !  B ! /$M-0MPU \$ 0@S`PP P T0 n piRp000100%0+nP3 !Q 000%np0S% P%  X"$$pP0: S40@ S p#*0cP8 4!8!41p)RЍppp p pPif3g4fggqg@-@#6&0 066d0S CQQQQQQ|QQ# @可0SQ@QPiA-Pp`b@PH0H0L0 @400,p6/P@P lhʚ;M-0MuS@ > 0mЍ0bS0iS0`!S:Sp R h0 m0\ P  _\e    m00S D pvbPPm 0P0076i>066=66{> 077=0H7L7u>P7T70X7\7v>`7d7}>0''77a.x0 x0|00& &0$6(60]00@0008000ݮ嬮,0PQ pp.QЮr!\:\g Rd  \4`@V Q4p00Wpᴮ,<T ˮ pp;00: 0 0@ 0h4?o24D5@e0;`04, 0 04,0'#5 0074| l p倮%vR045US4045S4t0454?0U4tT5 U(1 !03 0#R$10C2r"0Cr!0CR0Ce0CVx4|d! V(1 !03 0#R$10C2r"0Cr!0CR0C0C W4;0L:0pD %0Xlp00Q0 :0 %0U 0E 90P0% :lUw᭄QrVp 0FmUtt4 c? 0%/ 4% %*%,%@ %8 |%l%t%0 d%!\%7 B=`0N( 0pxńuńP%T5hm8Wp0L "pP707C4W  `PV570770 / R6 HH80%088040k`OOO|OO!p70P`%0\ 0Vt$x4|$Հ4ՂpR' %k `P ``P| 0 4SX`P 0SP7007000707 `P7& 070#201 R 00600%bkfL4/0XĄpĔ\00H5l4(/ 08#00<5`t40c0Q 60%08k`hhl00P000D05TP @b 4P 0|50x%0`$5` 50h5N? ` 505l!,"QB"` 0^lh0pt >`P!<%4t0C40Aa0 0 B0`P? ` = `Pltd PO`d`34 4 8 dPPd0 0 pd0 0`d0` 0<  < &V( e ( d <00<05%jQPP z^ E `0LĔLAA?/\/2#! 0 0$  "   X(0707 PPfQ> C PP]&PP; $  !PP,$77[s PP\q PPX70 7& ppkeJ %PP xq4200%4jPa}n`pP:xp`xP<*?%PAP `@V AP3GN BN@Nd0S6 y300PP0$D$076&0 066 0 ppN @0 ``Np@N`,04P1;,0 pTdhMg1f ndmdPi$Dfgfgg:g0Bg4gfżgsgg@icgfgg odJgfYg@-@P 0MLiT0@-0@S  40  p iPi8Xhg0@ RP/B"Q@-0 1 #0+P Ѝ7@-t4P0c^@P @ 000 :rPP M@ Ѝ0M-g0M` Pi`0ЍP p@`Q0P $R0(S0, }0|R~00ڠ Q 0 0$7`00 %!i0S``NM0@000S S `hdV0l4) (04* 8+ <4- ,04. 8/ <4100 5$20(30,404687<&9 804: 8; < 4= <04> 8? <44@0A 4B 8C <@4E D04F 8G <0`0I H04J 8K (?,x&A@ $B(C, ED $F(G, I HpLtJ xK |M N O u yx $z({,&}| $~(,& $(,& $(,& $(,p' $(,t' $(,' $(,' $(,' PT X \T $(,$ `Pd Th lQ R S U V W Y X]ČZ Ȍ[ ̌\ $^(_Ą,$a `Čb Ȍc ěd $f(gĄ,$i hmČj Ȍk ̌l $n(oĄ,$qp u $r (s ,tČvȌw$̌Ą(u,(PP` PPp@ 060,%0ep{p0 0p0050%0ePnPTTT!$ $Ą ( 0$ $ $ $ 0$P $Q $R $S $T $U $V $W 0$p $q $r $s $t $u $v $w  0Q * P *0 s*0 R 40R40SdSt$B0唤 SPtS0V0SSxW00Z0SW00Z0SP$ }V00?PPL406050 5 00  S 0 0*68 S<S6S0VX00[0S6S$ $0c}$0VQp'X00[0St7S&0V0 7X[X7S|&0Vx7WppZpWr4Sq  BSm0$S00Ӣ?h 4ĔR  /`^$Q\YdVWppT0 P M܄t   ` `V >:S=:;Sp:9 0000000%0cd0000000 0 0 0 0 0000000000*fg'fNgؾfgM-ĐL4  B00BC1 R@``BFa00BC1pfQ7vQ0 Q(1 !03 0#R$10C2r"0Cr!0CR0C4D0CT6 T(1 !3 #R$1N2r"Nr!NRN Q&$"H%!  BB1BqR(13 #R$1J2r"Jr!JRJQ Q(1 !3 #R$1H2rr!HRH  BB! RⰆ R(1P3 P#R$1PE2r"PEr E [ B\& \ Ƞ1P3 P#\ Ġ1PE2|  PE| E[LP P  1!' @ƀ @B"B. 01#ȱ ϬUA6Ķ  ϬS0ÏFo@P'ǀQpt0Q0qp00S0P07ǀЍpS p `@PQ 6 0C0 //p@-` 0P@ 0SV & BR R4&&0C0 PR p8^<^S  Qpp@-`Px@ 0 S pPUpƐ0L\1/-0\A1M-@ 0` 0S`PUtWt>{ W00 ?   PW@T@-}7'0 0/@S0 00z4$0R l00h%0bЍW&4R(00(%0006|f$gYg@-`pV@ Pb' N^ȣdd d(d0 fR&0 5 3 0 40 84 0 04 8 <N^hdpddd004084004800@-P`pVO@P $  `p0S 0@{0 R  R(00$%0Z3> Ѝfhg 0 8 R0  /p@-@ PR B`0Q   RJ pp0 S B ppp@-@0` 0RP0Q  0 S pp0S0p pM- M@0 p  0`|먎0PP 0 10P %0YU 0QPPE_oR  04 8 < S P Ѝ0X0 $0(0,ZX0 7  BS 04 8 <Pfg1A-P`UprNPP @#   @PL@PP  b=2p30 tW 8U@P0S@ @@@@OM-@0(p00P `PPЍP/  p00P 0 ^4\ 00 P P00CR P p0000 p P 00P4 0R0 dPP PA-0PS`  P@7p 0 @P@ T@P \ @P MP00000\ :/4\/!0@-C@ 000S0Q00000\:04\0(M-M0P@p0 p4R Xo᫲[ 0S0S X `0㖃#`D0S @ <P<@DHTM`P Ѝ0S P㤀Zpĕ0>S \! 0KC# 0Qa40>S] H+0Se [X 0?[_0 0S[40>SW00 0?[B 00S>40>S:0C#0Q40>S1 L @000 0!404!0C# 0000\5 IXK 0ZT0S,0@` 000L0S 0 [ C@ /0L Z K`` 000000S 80S`80  000 00 0HLP> 00000000 0!404!#8@#0<00@00D0#P`$0㤀娀嬀0A-P`UpbLPP @& 0 @P @ 9@PP O;2p30 tW 8R@P0S@ @@@@OM-@0M00味#P08 P _Z Z= <0S? `Zp p8 Z`Ve 00 p\ P=` 00PQ4 0RM08 P)PD P`I P 0 0p 00 p` 00CS0s ^p00P 0 #0 P 40R0S0O p@ 0@00S  2#D R@ </ R E-pP0@p000!D0<r`PJ   Ѝ0` XZ(p`@ 0!40C4!P0SJ 000 0!404! 0!000!0S pG'0C00V2`VXq0S0S 0 p? p``0S#<00@00D00堀 0!40C4!0S8'8H080pS`` JP y000 0!404! 0!000!@<ip@-P3,@T ,`8@@pM-P0`Sp 0 a p@ " 0 0 0S@ 0S08P  0 > p@ ЍP0>0CS0s p00P@ 0##0P40Q@ M- MPp 0@@`PG ?W 0#<@000,>0CS0+0; P%0 P  0 mP  W0 0< @000>0CS   Ѝ E-,M`P 0Hp@P !0 0 ` P$p-P ,ЍP0 0@ 000!D0<<`@PDp@- 0 @PP ~ Ѝ AP @-`0 @PPh Ѝp7 00 0`7P 0S0M p  P 0 `M-8Mp 0إP`s@P:T;7 0 @P@+0S0  p@ 0 T @0`0`000!D0<J<@pD@P# 8ЍT " 0 0(@,0p4l@P7 @0@@0@P ^gM-P Mp0 R0P 0S0* p%0s p0 Pj0 2"0 P:4 \ : P: 1#4 0R@`0 0S0 @D00T0 0@0@j* 0S9 0C0 60P * b"00S:4 Q: S:0c#4 0R0  !D0<0P  0 0 Ѝ@ @M-0 pP`@P0S! T 2@P 7 00 0P@Ѝ0 T @0 D GP @ 00R 40>S 0  @P 5@M-2 M`p``` 0 p@pP!50 0  0P)0( *0+08003 204 08PP 5 Ѝ   PP500`0p@-P@U 0P 5U 0UP TY0!( 00C0!55p@<i@-0P^@ `p@T:`@V: P/-0S08 R0 S R -008SP0 /M-p`@P80ST0`*5P 0S0`5P@M-0M@H( ,0 FPP PR 0< 0000 00pE`P 0000 0pP44P404000p tpp4 WR '0$00SG CR4 0!404!0!#000!0P(000 0,000Ѝ Ls0 p0%4wP00<0p0%mP0 0 000020%0`P24pl4$ 0 0 $ 40Č0Ȍ0̌<000@ 0 $ 0( 0,0D 80P4\ 4\Ϝ0S0 100%P0Z ! %P0W3`5\SR, d0%dO\500%HO0R00R0S 0%O`50\500%O0l10H0P:40LS: x00 0%O0S>0CS <00 0%HO0D  p<iPfg>gCgggg.!N 0 $ 0 ( 0,48 8ZNA @0C4B 8QNE D0G4F 8HNI H0K4J h 8?NM L0O4N H 86NT0U4 1Na0` e$b0c(d0,4f 8g 4 8MA @0C4B  8ME D0G4F 8MI0H M$J0K(L0,4N 8O?8P ,R<S\LI0H M$J0Y(L0K4NO8X ,Z<[$DLA0@ E$B0U(D0C4FG8T ,V<W,La `0c4b 8#Le d0g4f 8Li h0k4j h8Lm l0o4n \8Lu t0w4v $8Ky x0{4z 8K 04 8K0Kq p0s4r 8KHЍ302` d000000c0K)0( -$*0+(,0,4.88/7@-p<QFA"JVa@@P0a Ѝ0 >PP/0S@/d0SP/ RP/ /p@-@PP 0S00d0S  38 8 40 0 0$\ BX00/X0\ p P  p@-DT@H4SD4H6LpJPpPM-@P 0@@1R?08MD60c>P4 U D4Pf0H60VL6$a>000(`,0H4 R00|6 ~ pPup 00|6 1 pP`U`8Ѝp0 W0SL000 R 0 00 200%H$`4$, !$  P$  5 5$ 5 5( R$ #2X S    $ ! %H048< 0C1(0(0 S 0(0p$娃0100P<,40=P5 ,40$Q@4@0,40 6  0 (00(006 00$0X2:0,0H60L6U8ЍM `D 0`d>gfg0 CQ/ R /P/ 0S/!M-~^Pp`@T(L=P " p!(0 0@@r 0S`` M-pM4e 0)=P PY 00$  PJpP@@'x<QP(*T< 0f@D0PE00 0@ Tp" 0fP@D00 0@p P+ 008 00 4 8 <S@Kp0S 0@PKP4S0PЍ V TKP80P4`VJP1E-0$M0 0000004 00@qPP00 0hpPPX ` ( 0H; S, Q  AS9  S- Pa`%0NGpW `%0EGpW `%09G h+;0S Q  Q r:0S Q:  AS,z/BP,ǽ4  ?<P/ ,㻽 )(04*8+<0#(0)##<*+0++)+$ЍQ S40C 0C SSX $0H0Sʅ Pfg-gkgM- M0@0儤sd0 J@ 03<0 000@Py p`p  Ѝ00 0`pb0 Pp 04 8 <00`PJZ00l|$0 b0CALP 0tSP@0Sj 0t4 `C`0c`F 4$ B0 V0S 0 0004 7P;P 0P 0}N 0 @@0P`PJ0 RS00" x%6F00X20X%0,F plx$ 04 8 |40c@JP00 0Bup[|4 C0c@Jr Pq|$0 b0CAPf X00<1`0 8%0E`P0  t0S $00SK 0 )00C00S=0U 0 @000)00C0Z.D000%<E00 0` e)fgFggDgM- $ R8 (MRP 0 p p p`;0S 7̷  o :@P| 4 0CS 0p0 0JPJpp0  p 10% 0REp10%0JE|)`(Ѝ0 S 0L10P% 07E0 $0(0,048<SR 00%0E 04 8 <$0   =)$0  S *p000%\DQt` pK00 0`[fvg9gggXftgp@-P~@T `$P y)@Gp0@-0M>S,@( P S+ S \ @P ~(Ѝz0P @ `p0`wkP 0Q0 @0 ]P @A-~P#@T 0S(  0|&00p P Ѝ|6 1 052 3 4 $670(<0 0S" 0 P04 & p0( ,^ (, $!a`@$0`a(@Q A0\0:///M- p` 0@R080P4>9P U0  00 0P0P"` P! {N"#"$# 0 @@0 A-302 0p4 P8 ~<9 S W00000%0CЍX1 00R0S@08`V8K?X) (0-4* 8+ <, $.(/,Q :0GS 00p%0gg!fggM-pM@c pP 0P0 01   pPU4 0CR  00>0%0nCPpЍ700}78'|f   0  pPup 7 0  pPU g{~J0Sp p`P7070S;  0 pK R -00 %"C    $(,R Q  0`-0 L %C00,=00% B$K  $ (  $0(< 0P0:0S <0 %0B0p8080W(0S4 4R0040`V00S {>⼇<0 04040X<0,pg}`F0W:gp!R:;0 %0KR * x;0 %0BP 10S S 0;0H %0$`0 0!004 8 < $"(#,`0 R]*ZZPZWSTt(0AO P 0 (0R SE*0`:0X %0 0 4 8  04 8 <00! 04" 8# <<40!"O7`P < J7 PJ&m P000400< < `{> 0'0 p-0S wO8(00  %AP04X80S~( d03 40S  S 0`00(0 000|6  (0  ppPv0000h 0 Ph r   (0 0`X0X0V(00 0C` 0C04 0C0!R:70x%0A00(00l70h%0|A$NP 10S'e(e(e(eh*e$010 5$2(34 $6(7 ,$ `  ]\ $^_0(,000! 00( 0 #PPy $ )(04*+ 8<6  0`0$ 0 $P9P0@0 08080D0302 $8T0)0(,*0+08-0.0/0\  000P00S0%*6PP \ $6\ 0P#%  8``(@8 P 80, Dჷ80T !(<007 '0 `$0) (-* 0+ 5P , /$.(1,Č2Ȍ3̌46P7P J@DUZ ZP\P^ 30%0PP01l0`000h $ 0! h01 0( 430 0%(m@ P+! $0 > CR(  PP  00 39 S S  PP7/``F40?:#: "&*:,#:0?(:#: 0!#6:0C "2`d hh `l0g00  o   90 pP 0 R$QS B0C0  0 ? pP0 d A PP`40S4<%P$0>0CS0#0 0 000#0 `Cw 0 ``#u;fLgnfgggBgeggTghf ggfgRggp@-@mPPp60C6 0 PP#M-PPM  ML\ʂ\:Kxy?Sj A0 $0   0 6P 44f?$0 $ B 0R ( ( `p@DT 0 c 00 0 M 0 5 Р20 5Zdh0a@ 0 `BW 0 5P$  εg"f?gUgpgH 0BS/$0@-A0`Q!V(P8@, ` pFW0`  B,H S$0S C1#  0M-PM,< 00 0,00 0$S 00C, BR 0,0@D@@@$0<00@0 0D00D080(020(004S80 L@@\ b04 Ġ1A$1 RQqd„P sM@ DP[ 8P`ŠPPKPE`8PPeVŌ[L$Z$Z JJQP4 a1$1U qUfbbFA B\`@ $<@ QT7`P[KP#  Z03# Jl0PQP0PP4P4p PPqHpqP41$1UU gr4`HP\p4`A BrGLBD\Ap@4 B Ġ1a$1ETf43   T4D1$1Š \\KnB0@@p\Q(PP4a Ġ1$1UUfbL B(PbF^`:@D ZpW䠑펒'\P Ġ1E4$1T Be@LRRETP4QD1$1Š a\ BKe DRRE\P@4Q Ġ1$1EaT Be@LRRETP4QD1$1Š a\ BKe DRRE\P@4Q Ġ1$1EaTe B@LRRETP4QD1$1Š a\Ke@AR BRE DQP)@ Q@aN 4@(@4P\Pa0PP4 Ġ1$1U@UfbL B(PbF@0P^a(PP(P @T@ @T*Z3 #$@ Q# PAUP!`[`#K`@D```(@@V@ @8: AP P``UbFL Ba @`@PЍ\@40p Ġ1`$1ET2f0TP4PD1$1Š \KaBAP[@K@# Z A @D BZ4 L  L\bF B```@4P Ġ1$1ETeL\RE BP@4 Ġ1P$1ETe…   BRE@LP  @DTN B4D1$1Š \KnB0@@N B D|@N\4 Ġ1$1 BP^ @ \4 Ġ1L$1^dBBD BLL@^ Q@41$1E aTe B@NRRETP Q4D1$1 a^Ke BRD@REPP^ Q A41$1Š \eR B NREqP(   J4\40(0H00,00<0 0$1@00 D0 0 Ġ1S00,$84, $0SH *0<S*h0R`0RH0  4`ppppWVM-,P4`\@rP 0 *QE*4Š ST*0sM@ p$PP(p@peW H$V\Q*Q"* Ġ4S"L 0C 1P\3#Q3\$`8PVpF(5#`\`p\*Q* Ġ4S"P11L 0C P!^ @`P 0Ca*Q*4Sc*3m`p^*Q*4Š S*bP\*Q*` Ġ4eS"L 0C 1 X:W N^䠑펒'`Q\p*Q*P Ġ4U`S`"L 0C 1?V@F^~ ^P|`nPE` A`\q*Q* Ġ4`SL 0C `"1PU`@ P0`0C*Qm*4S*p^*Q`*4S*Q # 3P #RN0CSm` ps@P``0C*QB*4S:@P0C*Q4*4S0C @ N^ 0C*Q$*4Š SR0_23S:[ 0CP NMPE\*Q* Ġ4 CN PU0C2M@Pu0 $0L H0X0,000P /M-`pPo,0@H0<#S 0S, 00 P%L0S VX0+ S\ Rf^0]8<`L 0_X 4 000$0 SW:H0S 0S0, 0Ѝ X 0 \ 0`F00S0(0S50(0S P0S  <2s>0  S(0D0@0<080040P0X XNV 00S F    P \⾰X`000, 00 P Z PP0 PC `F Pe 00X  V00S \0X  00P0 0[P Z 00P 0 B 0B0`HX@-@03/00p@-` 0LC0sNSP@ T0S 03/T@oppR/pp@- 0@4 8 < S:3 0PU Q40#0 #10Qp98@- P@`P P ЍpM-@[0xM00#00p0P` Pp00000 0 P0 R,  nxЍN@-4M p0C@` P$0凯 0 S!0 AS\  |p0(0rh0,00 S3:S0 (000000 $0 p@004ЍIeIeQ/ p@-@P' R`$QP!$0S0$0(0,Sx0(0 $03/0P @ 0 d  (`T P L ,0PppptJeJe,-00 ^ 0BSM-P5 @T2 0S/: 0PU, U0  ( R Sm:`00 0 R P  00`,@"<#14#`< 0 0C 0000 00C0 0000 R   0@@ʓ0^0 08P 0<0|0 Up GRT  2*P|PP(( Z8 P<P UPPEU! ^P@ S<0 0 00 R 0JS0 3: 880U80 優  RPPPPE U,Z P@$r Q<o  S J\ <ʠ00 Ƞ 0U80ȩ  \ PPLP\ "Z @TC Q< @ \ S PEQQP1000\80YQ QPAQ "  @Ą̠ QS LR<  2,00(( Q8 0p(!0 S 00CS 0<@0@@Q 08

0  P 0l=S   0S0C1 0 2> 0X[0  h<0S h<0|-h<  Rh<S 0P000 0S 0C2# 00(00CS00 0S&0C 013,0   0SC0 310%e,  P( R0z-e; Np,0\̿04040( S ⫼|0l`p00( S K0 ` Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R   { Qo 0 0000 00C0 0000 R   j QR 0 0000 00C0 0000 R   ^ Q5 0 0000 00C0 0000 R   N Q 0 0000 00C0 0000 R   > Q 0 0000 00C0 0000 R   . Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R   @ E P 0  0000 00C0 0000 R   Pz 0  000000C00000Q   P] 0 0000 00C0 0000 R    P@ 0 0000 00C0 0000 R   P# 0  000000C00000Q  (0Sʞx A0x \0Pp `s`!00 0S  0C2# 0000P0[400 P 0 0000 00C0 0000 R   000CS["00 0S 0C2# 0I #00 0S' 0C2# 0000000C00 P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R   400 30 0<` z S0V`PR-0 00`l00 `0=(0p%?40h<0X0$0C.T<0 Rz: <>  ` R`l*0!0CS,0S4:>$0=>01P$0p31,l  < ,<00  @010D LP0p$00 0S 0C2#U 0<01 SP%00 0S# 0C2# ⊠8 P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R   @0(10JSD 1 0SG000:|>0|>0|!@00@0(0S0S)T0SL<0p0C0T0SP,00p0C00ST0S 00CSz*|   |.\` A!1!> 000Q`|. |!@00@0(0SL<P,00pS 000 ,0S0z=<0$0=>010L0$031,l  < ,<00  @020D 00LP0C0(00 0St 0C2#U 0u<01 SP)00 0S 0C2# ⊠8 z{yzxywAL|sA#ʌ|00 k> 0|.0`FP9y|y <00C010 P||>0C|>S|.s 0z @h0< 0l0h0:=\l 0 0`d\sl\d\<A`FQ`Rs Pk 0 0000 00C0 0000 R   j PN 0 0000 00C0 0000 R   _@0-10JSD 1 0X0 SU R0H000H0 0SH00000S 000,0S%0z=<0$0=>010L0$031l<<00@020D00LP0C0H &00 0S; 0C2#U 0|<01 SiP'00 0SF 0C2# ⊠8 4 R00?e `,  C. 00D4 <0R=0!- R(0S =R0SP S40T,  2,((T  Pl0ᾀ0T C8 40P`0V8 @4> 00F80T,< 02!P(0( 8 @4 0R@400 S  00CS 0< !HT̔ HNH0HHN 80T,< 02!P(0( @48 0@4!!DĒ  D0DSL401 #4Pǿ80@$   1#80@AQ0#<01 #4800< @4 Q 0 0000 00C0 0000 R    P 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R    Qg 0 0000 00C0 0000 R    QJ 0 0000 00C0 0000 R    Q- 0 0000 00C0 0000 R    Q 0 0000 00C0 0000 R   r Q 0 0000 00C0 0000 R   b Q 0 0000 00C0 0000 R   R,g(epppH T\hA-@ p P`U-A XPP^^%@00RP@0X S a 0R0S! b!0X`^PPPa`a@N`0C0 $ R/00#000 #f-(0LR0 4#00 #fs@-`P@PЍp0 .RVDPUD`U*PUD$ 4 8$DL7@-@Q PP <*0S@U@T Ѝ000 P0  0B8C8/ @- 00o0S]00/  S. \  00S000\\00\ P0R000^ @ ^\0^0 000S0R /@-0@- R< R0P\ 0\00 R~ 0P S   ^ O P @ 0  0\ 00S0P  0 R @0 0 \ PP  T 0000 ^@@0\  0\@@P@9S  0 0P S   ^  P \  0R0 0I 0P/0P/P/0P/0P 0S 0S/0 S/0S //0P R/ R/0S/0S/P/0PP/A-p@P `TUT@@Ѝ 8/P@P@P`0Q/M-`M @pT q0PP0S`V8` aT`PVS:V`` 7/0PP0S@P`Ѝ `  RVVP0P'0`` aT00 ` 0!R 0` 07/0P`0PP`0Pg[  M-  B0@8M000#03P00S0000 0@0C(@A (,,040LPX T8<$P@ $AQ@> @@0  P5 202> @PP@ `@Q@P>@ P *@@Q`҅ 䎀 @A@>(@CT,`DQ *!B \ L B  b S %0B00C <2결@{JXT @^@P@T@EX@㲠Ჰ@ T㲠`V$P. PpCp#  h# dC$ `#  UP!U!1p*  @/o"P *[RP3P"U xЍ@T x@ంT∀ᰢD`` $  * B(   A`@Pg:Th:@D$`@ @ @@A`0 45 @4 ``@0` [AGP@@@x@PDU@DH$HTDEQY ,@ Q)(@P@T$ RP A8PPlPU*PPFUP\P`P[VP3P"U~P@PQPaPHEQPP @``R ( \  p0a@A̠\ LPp @`P ! 6f8fff P 0S 4) S. (,08<l P L //R9 <S1R  3Pp@-@p 0 S(0$0  S0$0 0P(3/P U0Pe0 E20/U0$0( 3/00P0ES0$P40p@/pe e0%@-@P  R $0S 4Q ( 3/($0 3/M-RH M` X$H 0@3TLD@DPU\EPE,Q) Rpp2W$W  Q u0`ppV<@<P0@PVX2\TLD@D< ЍV}GW=0pG 00RRR0 R  R0  R  R 0   R0 R RR0 RRR@R0R 000 0 000 0@00P0 Sl<Vm0`@f<PR0RR0 R0 0 R0 R 0 R0 R 0 R0R 0 R0R 0 R0R 0 R@R0 0 @APT0@PWM-P0M> @T; 0S0S508` S 00 0 000000 R&4000   ,bP0`0U 0S`0   ,,`P0`0U 0S  0&$ 0   ,bP0`00; U 0@`S`0 P`000 & @0W1![ R P  A \  B _0   @0 pG 0C @0@0S(0@0000;d W J 0S  \ @ 0Q02@057[W0    h [pGE 0 000p(08`Sl0L00T0/>0T00 l0p0P060h000`d000h800P6cPE0 h0h R0*TL 0SWh 0pGePP PzPk6c0EaPC0XWP pGePPR6cPEFh50000S S>l0L0T 0/T0pl0 ` $0 Y 0P0$05fl `P  X X  d G0P04V004 WR9T0L0  R1AW 0pGeP06&aPE\!@ P0*hwW pGePW pGePP6c0E cPC 0 000p8`:ppp.xp't.pp\ WPJ Z  AA +AAPL,|, A Ppp^ AAM-0@0fPЍ 0 $"448#8% S@2@" p@% S @2@"00@0T#*P0X\0P0TpGp`0hl0 @`0Td0FS*[:U ϒ@pK 0  P*PpGp 0S  "<<0"$,Ġ0!,, !  R "Ġ "$ , R  ""$, R /PR $ ""$, s/// /PP P($// /0# $ (#4<0,Ġ#, #4 <0"S~@-0#L$L(#4@<@Ts "<Ġ< "$ 0,0ShTf:0#,Ġ, #4 < P\RZ,< <,Ġ 0 0PR3\J  < ,<,Ġ 0 0PR3T$\8 ,< <,Ġ0 0PR3P( Ġ  03#R3"Q\ $.̠ĎH. 03#R3 "/  p@- <Ġ<  000#3&Pp(,L d Lh,Ġ@ Up,L T LX,Ġ@ \ p($ "̠ĎH"$, Qppp0A-0` pP 0@\$#\(#4<PP 000ESxeeeelelelelee P @P 0S DP @@@ P "<<"$0,0 ,, ,,Ġ R@S@0Q@- Ѝ P0Q@- Ѝ P0Qs@-`P0P@@ uP P PU000ЍpU 00CS0@@T@Ut@@-0 0P0S Ѝ@-0@0 P0SSЍA-@Pp`PEPT@ P @p@-`RP@Pp0#,,#4 < V:pp "<Ġ< "$ 0,0 * "<Ġ< "$ 0,00CQ//7@-P@ P P@T @ Ѝ0P @p@-@`P;PUp U"<<"$0,0p0#,,#4 <00pp@-@`P0PS "  "$,SK CĠ!<< ! 00S%V<0#Ġ #4 <0S !<Ġ< ! 00V&*CR !@]P U@ppSVf 0##4<0\ R ! 0U@000 / A-`pP@!P9P' !,Ġ, !  Ġ# #4 <00  !<<!00""$, p@-@PPPp0 ##4<"<<"$0,00 PA-`pPP(DP#(L4L8@0(#,,#4@ <@0@S@/7P @U  U@A-`Pp@P0@0#ЍS `P 0U gP 0S  @P0@S   @0 ZS@p@-P`@ 0p@@-@P@@-@P@M-(p,P`P@W@! P  , 4 8,Ġ P 0V  PZ@ Ѝ @7@-@, T X,Ġ \T 00 Ѝ0@-Pp`@i p0 Ѝ@- @P 0#,,#4 <0S 0 0 0#,,#4 <0S ЍA- pP`@P X  , 4 8,Ġ !PV00Ѝ0#,,#4 <0S P 0#,,#4 <0S @-Pp`@ p0 Ѝ7@-x 0@PP 0S T 0P 0S0# $ (#4< Ѝ0 ggs@-P0@`BP0 \Ѝp%JgA-p@CPP.0`/SP  /FP HPP @PT:T 0@/S  F/* P@@0DyPPp@-P@~ p@A-pP@`PT Ѝ0SPV0S P0?0Spp @- 0P Ѝp@-@P Pp0p@ B0Asp@-@`P@P p7P LP@A-@Pp`U  P  0P@C@PE@@-@0( P  oЍ^gp@-P@`vPp P@ ppPp@-0@000ZЍ P p ,0`$0P////hf6gg+g@-0#̠̌#4<'\. .<D!># ! @T ЍM/ P# pC'0 c5( > `!PCUC!c6Z 吺. 2SX>W U \;A?o20S PE (0 0@S U `gggggM-PMp@pt`@SP@#@T#@x 0R3!:   Tp1 `Z@D04# 0V&0 .@S P00HC PЍU0 1 U0000 0  `0 `  @0gg1f gM- MP@p@S`@#PU#P001(0 !(  01C Р0$0 $0 0P0m, $ ,0@DpP K T0@- R 0 R0#01 # 0 @PUS0 B0` 00#01R #0  ..  .. f@-A-`PQp@#`F0@P0T  T # 2RW :pW`0?@ OP@-*g@-郁p@-`P @@P    <p@-@ 2@ +p@-P`@P  Zp0 0 /1f@-@0P 0C40S *000C 1f 0 # BR /  0M-^ 0Kp0` P PPE VX@P TЍ[ TPN US0^ 03#0N2&*QY@ 0C TN@ @@@A@ P U TPN @$ @$`K`U 1@\VPP0S pCQ@ P&U( `pW  p[#!pPW ` `r@@@T 0@C$0 0 S vE-@0 $MPt` hp 0 @ S$Ѝ 0000S  0 gg B@-0 ^@ L QT^0@-@  @Ig@flg/00M-PȀ`Ap @ \ X( ^T @U@@D3#VZ p^ >.00C0T>. <# PEP D0M0A-@@\A PH\P`q\```L Q\0B C   @ A U`M-` "0F`  p kP S( R:Z  B@k X * # R@e @e @ T T 3R0C `F  05 0P 0 tP@Ѝ r"@U@Dp@-P`@P pXg0p@-P`0P S# F 0 00CRP@@p ^Pp@- PP@ Q0 0CS%0 00SCp 0Sp/0p@-000`00@ @RP <H R D2Vpp@)p@-P0000@00Upp@p@-`PV @U:LLQϠ\ RPpR QáVQ R`@D@DQ!R  A- @ ^5PB\p*XR00` V` V ^ `V ࠑ000 S    /2S0 "2/g2S 0"2/g0 tP/mPSP dP 0P//n0@Sdfhfhfhf<fLfDf / / / / / /p@-P`"@ B202pM-0`4p@PQ8 0AS,f\fflff0fTfff0fhfLffff f<f00 0@0 0PP0 000 0@00PP @0P JRPЍ0 CP000@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `}00 0 @yPP 0 `0 S   0 S l 0@0b0 S < 0 S R0000P ^  R{0000P ^o P_oRU@,fP PE_oR[ 0 001@[ 0 0!00C0 1fgM-0@p0P` 0 0PЍ0 0P M-0@0P`p 0 0 P 00 P Ѝp@-Pt2 E0CS 0@20pgA-P@Q`p0S 0CP0[0WURPE `20CS 0@20gM-2@P`p00 .R#R RB 0b0QL$B Qfffff fLfLffff\RU ?R [R b^R00@^R |RW 7002p0CS 2 20000Ѝ b \Q ]Q   A0C0 R\12b @ sb `0 0)S 02 W00S0*R?Q0 0 C?Q0 0  PI0 x>7gggg#g7@-P RRRRR0^0C?o2 2Z@W00S0SJHGo Ѝ0E- p\M@` P   0 000 u Ѝ0  PiPU00\0SR l@-0@ P R P @@   RQ @B/1f  @00S/@ Q/00S/ 0\ 0C  R/R/- 0^A \S  0 S00\0S / P0/-P^\S0 R0/R/0 0QB/A-@R `pTPPD 2{@00p@-P@@0 SRpUp R0  \C/p@-PP @P@pe0 R/^^ R A-p@-PU @0P  0pP@-@0Sz Q sb0A S/ P/0A-@pw`P sPU@H@ PEP P/0\/h0S 0h@-eP@he@-/<# 0 Ѝ @-h0SeP0 heP 00M ЍCghg/@-@@@-@H 22< 0B0#30 !4ׂCp@-`@P@P 0P:pp@- `@TP1P!@Tp耖%/ @-0 {-@-Yp@-!R!DP@0!6 !Ơ! 5A0Q0p0C0000p 03 1A0pQ0C0000pM-00À P$!Q *M.t .`  0!  J"r"p`""f ++#8  e B0  L! q  e` B0  L # !`F0``L0 B0 L L #GGŧM-`M†` Z& `p@P 2 S) r0Qp Z@D-p/ @D-p Zj J ` @` 2 .3.30@D+pp@D pQ: Z@D @D0000Q@D> W Up5P0S U003050ZPX0PX00E 0S  0 0 R$Z?@DP@D 00# Z Z@D-p  @S50 RZ?@DP@D 0 S50S50 BQ@0 0S ZQ 0  RZT`ЍR 75 S50gA-R``Pp@0 0 CP PP  LPTDS50 APP0D 0c@D0P@0 S 4 50R5 gM-@M` 0!0!#  0%0S  R V050Z030J50F@Ѝ%S V05P$-S 0S3 00C Sp&00C \+0.S0:00@ \ ࠓ,*P/@0 )P0+S S #S *S pPP@PP 1!0pA@pWpgP +0K00@ \˿hP LQZQ zQ tQ 0xSbS%S XS V%03050S Z0ƅFlQlPLc0CS(f+f@(f@(f@(f@(f+f@(f@(f@(f@(f+f,f)f@(f@(f)f@(f+f@(f@(f+f0  S50AQW0GWppg`p V@10405 10` FQWpGp`+ S50@P0  0 00 aS' ISJ MS w P!Pp!iS@ mS@P%!p, 0@:!SQ0S  0aP p00 0 P @P0, P p0 0 @P0@P4S,@0( $0( $0D@QS @.0A0F q P0ESPP LQ@0@ 0  P~kHZlQ@ ZQ hQ0 S tQ 00 ? S!(A(?g1f@-@VP8TD -@- 00J ЍЍ/0 B-@-   Ѝ Ѝ/@-AMM 0 @P YAލЍ-@- ЍЍ/A-DP0@p0@P ^0' S`A0EXi7@-P @P0o Ѝ07@-P@DP0o Ѝ000S0D   00xS00 0S000S 00/1f0 0 D  009S0CWC/ /1f@-P p@`@WU` Ѝ! 0@-0@pP`P Ѝ 0S R 0C0S R-\ @-`@-@ d0 00kS mS gS000iS  0 BR001fA-P sp`@@WUЍ6!!`@-@ |0 00kS mS gS  000iS  0  BR001fQp@-P@_0AU*P Q P0C Tp@]UTp1f A-0S oP@ 0pS pWpPU `P0S ` Up AP@W@-@P @0M-X'ڤ0PHOBDEA`Cp d pQQZpp@0JE$80 1@ 0@Qm$fT0p@-`@PdQQDopugA-p!22[.B"B[(BB 0`0`#3`0&hD1 h@@${ 1{10R0 QESEPEU%0`00 `PUJ V0   0 0.50 @D< 20@D0@ 0HdsQmo[PJrQmQ ųM- p@p`83v%V1S00"0 t"QP BEt(^v`p@-P`3V1Sp00p(@@C0 00 "0 0S t 0A4v`Ht0SA-p@p`2RS R 0t P Bs v`0S# @@F$0 P  R 0Ss 0Au`3VsA-P`(p80@- R(1S 7ELFgg0 00( 0$ 0 00 00/iiiiiiM-鴀`p  @ P`   d`s  s s   psЍMifg1ip@-X`XPX 0L@0#  <00S0+00 p@i1i2ii1iglgx0P/@- ` `00@SH@00S0400(0 iiig1iRM-PM ЍM0 @4 S0 4SXpW0S  ` .s 0R0 4 S  S) ЍH! 00000 0P@s  s 0 s sP prЍM]p0S  r00Z`P  rx0P`P P@;/ r70000@g1i1iiiitii 0P/iM-Pc9}5RS @ @  ""$, 6  B B@B S #,,#4 <02   C, C( C$ 0@hP 7iP]0000@40@^0p0pphP<00` Qr7 0         B?PЍp_gjgTgA-@`T(QQPQ3 30A Rr,S@f Af`@fAf?f?f?f`@f`@f?f?f?f?f?f?f`@f,AfQXAfP@f?fl@f?f?f|@f?f?f?f?f?f@f?f?f`@f?f@f  qP@  Up 0 1p q00?Upژ@0 ?p㄀ t0 h \0XPp qPg2i1i1itg~gigiiii-i-is@- `@q \0RTP00_0 lY0 l,Ѝp@QЍpcSciM-M8PUPPCSPDQPU0@S0S0S 0  0iq 3#0SЍ PZ 0 Wq2 R0 R 5R@0SP Cq0S  l0l0`0uHЍi-g`mitiHi>gfgDi1iMb-iPiLi@iHf$BfP0@-bD00S8i@,0,}P}#]@BDiiRg@iHf<@-(?P Ѝp@-@0<00P3/ eopp@-@ y P>P $p0Spp@6xgg@-@PD00<00SHPh0 0 0 0 0 0 0<003/P&p@ @gg@-@{PA000 `PLP L P0<00SHq /o0 0 0 0 0 0Hq H<= 00 0 0 0 00&  0 0 0 0 0  -P I E B nk Ѝ3/ 0 0 0 0 0 H ( (!GJgAJg Vggߠgg)g@g_gs@-`P (@P U 04.Ѝp sn@-0@S(@em0Sp@-@P PU  (=,`P (nPP@p`i@-@P@@D0 0P`i@-@0S@-0`0 PP Pp(P0@ @ ЍU*P  pP ,@0,@D, 0RP 0SH0Wߠg@-P@-0P D0 G00@-v0PD0900@-kP hHA-^d@[dP 0T0P0S `P @M`P2@pP@U D0 0<003/@P0@000@H+VP|gggg`ip@- PPp@Pp0Sp0<003/0000p0P D00 @-@o/p@-P`@P P 0 <00p@/pps@-PP@ P@ `0 <003/@P10<0 0S `V t Ѝp0<0 0S  3/T@A-()@TЍc`P- PP* p崀@0D0 T 0 H}V 0Shv0D0@0STg Pggg5gg@-00 @-RPp@-`HMP@āP P0< <0 0 P$  HЍpg@-@ ( M0Q   ^c Ѝgg@-@ ( M0Q   dc Ѝgg@-(0 P$  cPЍgg@-P Jg@-xc@pbPPT LPT@0P|ggg@-@`bPPTD@ 0S$0  Pgli1igp@-pPp`0S@ 0S Tb@P <bP P p@hidi|gg 00 00 /iWfii0 /1i/ @-|0/1i @-p0/1i @-d0/2i @-X0/1i@-ZP  k?1i@-T@0S H0H 00@ ; 000@`dhitiip@- ,bQ@P 0S1 m@ pGP BP =P [0000o 0 Rd0 @ d00S@0  P0P !H0H D0 @0@ gpi1iggg1i1i1iiWf|i'xiiWf P 000/iWf0/i P 000/iWf@-@P<0@$0$ ? #30i|iMbxi@-P00iti3 Q3/3@-0#P#Sp3pß0  S#ĠČ 0 Ƞ$"4484##8,ȠSM0 @$"448#8 Ap& S* S%Ѝ@ S@ AQb 0 p$"448#8@ A   P ЍR04#ttx'xWW0 @R0SsP   j1 0SS00    j0 `$"449#9S 0S0S0S@Ѝ@ Ѝ@S0 4# P GR:0 $"44 P!$$@8(#8"(P 04#$4 $" 8 $$("( B D @#8 !4/t1i1ifdhddh1igi00 ,0R "44  //fdh0p@-`0 @S#TTX P%X,j |(jl0(",$0!  p~0 00 0 440#40 pfdh1ip@-P @j tj 0 (",$ 4P4 ! p(8#8S ą ą ĕĕp1i@- E #$40 #400@ 0 440#40@0000    i iP  Ѝ1i@- P`p 0X %X 0p 8 #8@(",40#408#<P$8#<T P"$%T P Ѝ1iM-耟pW0  Ar PPP`+`6, R@(0 0 0t (0@PT0@`L0PH0D0@<0Ѝtifglgiiiii@-  ЍQ 0"S B BQR0"SS00/0:@- P-iP@- Pddf4df4dfdfddf4dfgA-|`P@:PpP 7V P0 P  3@00D-i@- ""̠"40  Ѝ=g0P @-000C S,0x8#8# / @-0/ddh @-0/fdh@-M@ g0#,,#4 <0 R%:{ 0 00T 0T 0#,,#4 <0H 0ݍ0#,,#4 <0 :i:i:i 0R  P`/,#,#4 <0S&@-0@#,, #4< dUPP00CC1 ڍЍ",  (+dp$4 , p0pSPp T   :0 ിLp dUPP00CC1 hdhl:ip00s/d00S/-MM00 00000 0 0 RڍЍ:i:i41-0DM0CS-xf$yf|yfyfyfyfyf0 0Q 0$00 0$ $!0 0 0Q000 0 $ $!0 tDЍh0DЍuDЍL0DЍ+<080DЍDЍ :ihdh:i:i:ildhp@-0 Qp " RpB00CSyTzfxzfzfzf{f{f|{f |p0p0> |pp0Z|ppp px10S0s|pppTA0 LH100p|ppp(0p10S 00S0000 0+ p@G|ppp P0`0`0@|pPp}U\ 0000S0U,0  p:i :ixghdh1ig$:igldh:ig:i:id|f@-L@00S08@,0} "@:iggd|f1 A- Q1A0+0taP  h"<0"800 0@ 4q00@ 0S 0 R 00# @ Q  0}%00 |0/ t ?bЍA$:i :i1i:i2i1igg:iBgSg1i2ig-iggg@ggd|fyf:i :i:i1i@-0 1i@-P@p0 +@ p0 P@`R0 2110310PPPPPX0``P0p 80 Ѝ@y:itiBg~f'ilg1i:iiiiM-0@S S Ѝ  a0 0R0  Ȱ0S +pP  P PPP `a  aqHPPP`  g  PaЍM%:i1i1i@-D@M l u OP 0 0 ލ@g8;i<;i2@-pWa  B0PRsff$fLfffftf,@ Bp@1@|1x"#.d1p`0 @0S@ 810S( p@D@1! 0 T0   Ѝ+ 0@ "440, <0@, <0@, ;p0@@ti@;i:ig~TgdhMbgrdhgpdhgX;i\;i`;i1i1iP;i!g0gCg$M- PRd@ R BPQUpE Q   Q  QW\t!Ƞ ,Ƞ PU @\ D0^5$0 00$0 PDd HL ࣟ#@00W3 3 MEP#8#80# R*x00lP oT30 !"Q <000P]2P!R"" "Q0"00"00! M BRQPt"o \0 00T",2080L2 ,20hF Q(#002 2a 1PE!0 @ 10 # 3 0R l1 *QR S:pA `0X0U*PQgP ,l? !0 @0 RLl 0 000#$$("(4 "448#80CShX;i@;i\;iP;i2;i6;i4;iMb]gtdhrdheg~Tgdh|gfgL;iH;iD;igggT;ixdh`f|dh<;i8;ig1itg-id;i:gggg` @-000P SDD@8I404C,00S@T;i|dh*g?ggdh`f@;iE- s0S000UP nUP f2URP \Q*?0UbP LQx00 hBR`00@LL2LB0 0[4pP ("<0"80 00m  p|1!w0S 1 R 00# h AlbQ \|! G@P EX1 T L ЍE@1@D841pp$1 1 r 1E 1@t0 0@0p0@^0, ЍE!:irdhTgbgpdhqgdh}ggxdhgg`;i1i:i1ig$;igBg%g*g1i2ig-iVggg1igg<;iegg@;id;i`f|dhf\;iT;iX;i1iP;i6;i2;itdh Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-@-@g  NPa N N N NPp N@@B'@B@0u@ @ P@D)5:@ 0uP  'a'ȯ N'P''a:' N@B@BP0u::a Neȯ:8a  ':'0u N'P''::a:@B@Ba::hB Ne:8hB  ''a NP'':a'@B@B0u N':: Ne0u'8:  ''a N0u'': N'@B@Ba N':. Nea'8.  ''a N0u''::X@B@B N>X:' Ne NX8'ffffff ffff%f-f5f=fEfMfUf]fdfkfrfyfffffffffffMf^g^gfffTgTgTgTgTgTgTg Ug:g6g:g6g:ggg.g7ggg ggg\gg\g\g\gg^gigsggggggggggggggbhba4aa &``,#`&`|'`'`t%`!f8g=gBgHgRgWg`g0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-f1fggg8(HgafFgWgfgvgggggggggg*gg Wg qg g gg|gg g g g g  g<ggLgdgYgqgzgggVg ?Vg ?bg{g>gg Yg g g g |ggg*gFgg>gMg Yg g fg qg |gggggg g g g g qgg#ggbxbbbndmd9N]gf^\gxgEfc\g3Z'gKh\gLm\g'f&t\g~\gZ\g\gffff[gf%ff)f.f 3f8f=fHfSfMgXf_fkfqfyffffff (gf ff ffffffffffffffff"ff)f0f7f=fggxff[ffafffffkffoffsffggf.f9fNfkfcfifpfwf{fffffffffffffffffgg fff&fEff7f?fPfXf.fnf{ff ff ff&ff%fff(f6f2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      u-boot*EHCI Host Controller*print_cpuinfomv_phy_88e1121_init__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtraw_accessubi_remove_volusb_setup_descriptordev_get_parent_privdevice_remove__put_mtd_deviceallocate_partitionverify_bbt_descrnand_transfer_oobself_check_aiubi_detach_mtd_devcheck_avubi_open_volumeubi_eba_initubi_self_check_all_ffwl_get_wleubi_dump_flash__mvgbe_mdio_readphy_device_create_ehci_create_int_queueread_blockubifs_read_nodetake_gc_lnumvalidate_sbvalidate_masterubifs_scanubifs_tnc_read_nodedo_kill_orphansreplay_budfs_devreaddev_get_uclass_privadd_mtd_devicecreate_bbtnand_scan_taillate_analysisuif_initcheck_attaching_infoubi_resize_volumeubi_io_read_vid_hdrubi_wl_get_peb__mvgbe_mdio_writedo_readpageubifs_read_node_wbufinit_constants_sbubifs_read_superblockscan_for_masterubifs_scanned_corruptionread_znodeget_cs_sqnumvalidate_refnand_fill_oobvalidate_vid_hdrself_check_in_wl_treeubifs_finddirnand_detectself_check_vid_hdrubi_wl_put_pebubifs_lsself_check_peb_vid_hdrdo_workcrypto_comp_decompressvalidate_ec_hdrubi_do_workerubifs_decompressself_check_ec_hdrself_check_peb_ec_hdrubi_io_writeself_check_not_badubi_io_readdev_get_privcheck_corruptionautoresizeinit_volumesubi_io_read_ec_hdrubi_wl_init__mvgbe_sendubifs_readinit_constants_earlyubifs_read_masterread_pnodeubifs_start_scanubifs_recover_log_lebreplay_log_lebdev_get_uclass_platscan_pebio_initprocess_lvolself_check_volumeubi_io_mark_bad__mvgbe_recvubifs_sizeubifs_check_nodemount_ubifsubifs_read_nnodeubifs_scan_a_nodeubifs_recover_lebubifs_replay_journaldev_get_parent_platearly_erase_pebubi_attach_mtd_devubi_read_volume_tableubi_create_volumeubi_io_is_badubi_wl_scrub_pebubifs_is_mappedfree_orphanscheck_lpt_crctry_read_nodeubifs_recover_master_nodeubifs_validate_entryfdt_find_or_add_subnodedev_get_platubi_early_get_pebvtbl_checkdo_sync_erasewear_leveling_workervalidate_inodecheck_lpt_typeubifs_update_one_lpinsert_old_idxdevice_probevalidate_vid_hdrself_vtbl_checktorture_pebself_check_ecubifs_leb_unmapubifs_igetubifs_change_one_lpadd_to_listnor_erase_preparesync_eraseubifs_calc_lpt_geomnand_waitubi_add_to_avubi_io_sync_eraseerase_workerfilldirnand_select_chipubi_compare_lebsself_check_writeself_check_in_pqubifs_printdirubifs_leb_read(((((AAAAAABBBBBB(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Resetting CPU ... reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x undefined instruction software interrupt prefetch abort data abort fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... A1A0Z0Error.. %s:Unsupported Kirkwood SoC 88F%04x SoC: Kirkwood 88F%04x_%s sysrstdelaysysrstcmdCannot add window '%04x:%04x', conflicts with another window Err..%s could not read PHY dev address 88E1121 Initialized on %s egiga0egiga1Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) ## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize## Transferring control to RTEMS (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x.dtb./bootmlocalcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIP %s %s Loading Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIefiEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsizeWrong Ramdisk Image Format ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... %d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkpxedhcpUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-std/boot/extlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconf - must RESET the board to recover. ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order bootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 12.3.0-5) 12.3.0 GNU ld (GNU Binutils for Debian) 2.40.90.20230705 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s write %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL Out of memory bootflowBoot flowsscan## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrethaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootzboot Linux zImage image from memoryList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and informationunknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d dateget/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCSunMonTuesWednesThursFriSatur-necho args to console[-n] [args..] - echo args to console; -n suppresses newline## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structres Reset IDE: Cannot remove IDE (err=%dE) Init failed (err=%dE) diskbootboot from IDE deviceloadAddr dev:partIDE sub-systemreset - reset IDE controller ide info - show available IDE devices ide device [dev] - show or set current device ide part [dev] - print partition table of one or all IDE devices ide read addr blk# cnt ide write addr blk# cnt - read/write `cnt' blocks starting at block `blk#' to/from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type Unknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=spi-nandonenandinvalid partition number %d for device %s%d (%s) uImageJFFS2### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx ### %s LOAD ERROR<%x> for %s! ### filesystem type is %s fsinfoprint information about filesystems[ directory ]load binary file from a filesystem image[ off ] [ filename ] - load binary file from flash bank with offset 'off' %s ## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx crc32byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08lx: %08x %0lx %04x %02x ? Zero length ??? halfworddouble wordloopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mtddevnummtddevname%s%d,%dcannot add second partition at offset 0 mtdparts%llug%llum%lluk%llu%s%dDevice %s not found! %s: offset %08llx beyond flash size %08llx %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect invalid mtd device '%.*s' partition size too small (%llx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08llx@0x%08llxunexpected character '%c' at the end of device incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=orion_nandmtdparts=orion_nand:896K(uboot),128K(uboot_env),-@1M(root)mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts=device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions no partition id specified partition changed to %s%d,%d delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08llx 0x%08llx %d no partitions defined active partition: %s%d,%d - (%s) 0x%08llx @ 0x%08llx could not get current partition info defaults: mtdids : %s mtdparts: addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found define flash/nand partitionschpartchange active partition of a MTD devicepart-id - change active partition (e.g. part-id = nand0,1) of a MTD devicenot same typ %d != %d Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx Device %d: %s.jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Not a NAND device bootdevice ** No boot device ** ** Device %d not available %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b ecc strength %8d bits ecc step size %8d b subpagesize %8d b options 0x%08x bbt options 0x%08x nand_writesizenand_oobsizenand_erasesize (bbt reserved)quiet no devices available Device %d bad blocks: 0x%08llx%s erasescrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .raw.raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemactiveeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive rootpathdnsipdomainautoloadNET sub-systemlist - list available devices listpingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]boot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoltruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-eVolume %s not found! Couldnt or partially wrote data size > volume size! Aborting! Cannot start volume update updatingdamaged volume, update marker is setNo size specified -> Using max size (%lld) Read %zu bytes from volume %s to %p read from corrupted volume %dNO MEM read err %x UBI partition '%s' already selected Partition %s not found! %s,%sUBI init error %d Please check, if the correct MTD partition is used (size big enough?) dynamicstaticSettCleardetachError, no UBI device selected! Device %d: %s, MTD partition %s UBI: MTD device name: "%s" UBI: MTD device size: %llu MiB UBI: physical eraseblock size: %d bytes (%d KiB) UBI: logical eraseblock size: %d bytes UBI: number of good PEBs: %d UBI: number of bad PEBs: %d UBI: smallest flash I/O unit: %d UBI: VID header offset: %d (aligned %d) UBI: data offset: %d UBI: max. allowed volumes: %d UBI: wear-leveling threshold: %d UBI: number of internal volumes: %d UBI: number of user volumes: %d UBI: available PEBs: %d UBI: total number of reserved PEBs: %d UBI: number of PEBs reserved for bad PEB handling: %d UBI: max/mean erase counter: %d/%d -numeric%d: %s Error, no volume name passed create--skipcheckIncorrect type No space left in UBI device! Name too long! verify_mkvol_req failed %d Creating %s volume %s of size %lld removeRemove UBI volume %s (id %d) It's read-only mode Error changing Vol tabel record err=%x UBI: reserve more %d PEBs ubi%d error: %s: cannot remove volume %s, error %d %sing skip_check on volume %s Please see usage %lld bytes written to volume %s ubiubi commandsdetach - detach ubi from a mtd partition ubi part [part] [offset] - Show or set current partition (with optional VID header offset) ubi info [l[ayout]] - Display volume and ubi layout information ubi list [flags] - print the list of volumes ubi list [flags] - set environment variable to the list of volumes (flags can be -numeric) ubi check volumename - check if volumename exists ubi create[vol] volume [size] [type] [id] [--skipcheck] - create volume name with size ('-' for maximum available size) ubi write[vol] address volume size - Write volume from address with size ubi write.part address volume size [fullsize] - Write part of a volume from address ubi read[vol] address volume [size] - Read volume to address with size ubi remove[vol] volume - Remove volume ubi skipcheck volume on/off - Set or clear skip_check flag in volume header [Legends] volume: character name size: specified in bytes type: s[tatic] or d[ynamic] (default=dynamic)UBIFS not mounted, use ubifsmount to mount volume first! ** File not found %s ** UBIFS not mounted, use ubifs mount to mount volume first! No UBIFS volume mounted! ubifsloadload file from an UBIFS filesystem [bytes] - load file 'filename' to address 'addr'ubifslslist files in a directory[directory] - list files in a 'directory' (default '/')ubifsumountunmount UBIFS volume - unmount current volumeubifsmount - mount 'volume-name' volumeSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded BUNZIP2 ERROR %d - image not loaded fileaddrimxtractextract a part of a multi-image%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveexistssaveenvsave environment variables to persistent storageprebootNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort => *?[\%u%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective initcall sequence %p failed at call %p (err=%d) Net: load-environmentNAND: %lu MiB Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! #size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2023.07+dfsg-1u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesetherneteth%daddrlocal-mac-addressrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dNULL device name! mdio_register: non unique device name '%s' %s: %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: %.*s%*sy Y yes YES stdinstdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! CRC32 for %08lx ... %08lx ==> %08lx bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Supports 48-bit addressing Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBMMCHOSTNVMePV BLOCKVirtIOEFIUNKNOWN device %d -- Partition Type: %s Whole Disk** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** UBI** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%d%s:%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISO(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmapIDE read: device %d not ready Error (no IRQ) dev %d blk %lx: status %#02x Bus %d: ** Timeout ** not available OK blk#%dide_blkide_bootdevNo Powersaving mode %x u-boot,bootdev-ide%s: null device unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path %s: Device '%s' failed to remove on error path No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d Some drivers failed to bind Virtual root driver does not exist! Virtual root driver already exists! Some drivers were not found /clocks/firmwarerootroot_drivernopdevice '%s' failed to unbind %s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed child_post_remove()simple_bussimple-bussimple-mfdbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxRemoving MTD device #%d (%s) with use count %d Warning: MTD name "%s" is not unique! drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work "%s" partitions still in use, can't delete them Wrong mtdparts: %s MTD name too long: %s Could not find a valid device for %s Could not parse device %s Failed parsing MTD partitions from mtdparts! Failed parsing MTD %s OF partitions! Minimum partition size 4kiB, %lldB requested No closing ')' found in partition name Empty partition name No partitions allowed after a fill-up Unexpected character '%c' in mtdparts memory allocation error while creating partitions for "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx drivers/mtd/mtdpart.cWARNING at %s:%d/%s()! mtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only Not enough space to save partitions meta-data Partition size must be a multiple of %d Error when deleting partition "%s" (%d) fixed-partitionsread-onlynand%ddrivers/mtd/nand/raw/nand_bbt.cNo space left to write bad block table nand_bbt: can't scan flash and build the RAM-based BBT ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNQGAMA 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R‐BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitbad blockbbt reservedAttempt to erase non block-aligned data Size of erase exceeds limit Skipping %s at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx drivers/mtd/nand/raw/nand_base.cFailed to configure data interface to SDR timing mode 0 JEDECCould not find valid JEDEC parameter page; aborting nand-bus-widthnand-on-flash-bbtnand-ecc-modenand-ecc-algosofthwhw_syndromehw_oob_firstsoft_bchhammingnand-ecc-strengthnand-ecc-step-sizemust set both strength and step size in DT nand-ecc-maximizeInvalid ECC page accessors setup Invalid OOB size valueCould not get ECC infodrivers/mtd/ubi/attach.cubi%d error: %s: inconsistent vol_id ubi%d error: %s: inconsistent vol_type ubi%d error: %s: inconsistent used_ebs ubi%d error: %s: inconsistent data_pad ubi%d error: %s: inconsistent VID header at PEB %d ubi%d error: %s: unsupported on-flash UBI format ubi%d error: %s: VID of PEB %d header is bad, but it was OK earlier, err %d ubi%d error: %s: two LEBs with same sequence number %llu ubi%d error: %s: erase counter overflow at PEB %d, EC %d ubi%d error: %s: no free eraseblocks ubi%d error: %s: 'ubi_io_read_ec_hdr()' returned unknown code %d ubi%d error: %s: this UBI version is %d, image version is %d ubi%d error: %s: erase counter overflow, max is %d ubi%d error: %s: bad image sequence number %d in PEB %d, expected %d ubi%d error: %s: PEB %d contains corrupted VID header, and the data does not contain all 0xFF ubi%d error: %s: this may be a non-UBI PEB or a severe VID header corruption which requires manual inspection hexdump of PEB %d offset %d, length %dubi%d error: %s: 'ubi_io_read_vid_hdr()' returned unknown code %d ubi%d: "delete" compatible internal volume %d:%d found, will remove it ubi%d: read-only compatible internal volume %d:%d found, switch to read-only mode ubi%d: "preserve" compatible internal volume %d:%d found ubi%d error: %s: incompatible internal volume %d:%d found ubi%d: scanning is finished ubi%d error: %s: %d PEBs are corrupted and preserved Corrupted PEBs are:ubi%d error: %s: too many corrupted PEBs, refusing ubi%d: empty MTD device detected ubi%d error: %s: MTD device is not UBI-formatted and possibly contains non-UBI data - refusing it ubi%d error: %s: bad is_empty flag ubi%d error: %s: negative values ubi%d error: %s: bad vol_id ubi%d error: %s: highest_vol_id is %d, but vol_id %d is there ubi%d error: %s: bad vol_type ubi%d error: %s: bad data_pad ubi%d error: %s: bad ai->min_ec (%d), %d found ubi%d error: %s: bad ai->max_ec (%d), %d found ubi%d error: %s: too high PEB number %d, total PEBs %d ubi%d error: %s: bad lnum or used_ebs ubi%d error: %s: non-zero used_ebs ubi%d error: %s: incorrect highest_lnum or lnum ubi%d error: %s: bad leb_count, %d objects in the tree ubi%d error: %s: bad highest_lnum ubi%d error: %s: bad ai->vols_found %d, should be %d ubi%d error: %s: VID header is not OK (%d) ubi%d error: %s: bad sqnum %llu ubi%d error: %s: bad vol_id %d ubi%d error: %s: bad compat %d ubi%d error: %s: bad lnum %d ubi%d error: %s: bad used_ebs %d ubi%d error: %s: bad data_pad %d ubi%d error: %s: bad highest_lnum %d ubi%d error: %s: bad last_data_size %d ubi%d error: %s: PEB %d is not referred ubi%d error: %s: bad attaching information about LEB %d ubi%d error: %s: bad attaching information about volume %d ubi%d error: %s: mtd%d is already attached to ubi%d ubi%d error: %s: refuse attaching mtd%d - it is already emulated on top of UBI ubi%d error: %s: only %d UBI devices may be created ubi%d error: %s: already exists ubi%d: attaching mtd%d ubi%d error: %s: multiple regions, not implemented ubi%d error: %s: min. I/O unit (%d) is not power of 2 ubi%d error: %s: bad write buffer size %d for %d min. I/O unit ubi%d error: %s: unaligned VID header shift %d ubi%d error: %s: bad VID header (%d) or data offsets (%d) ubi%d: MTD device %d is write-protected, attach in read-only mode ubi%d error: %s: failed to attach mtd%d, error %d ubi%d error: %s: cannot clean auto-resize flag for volume %d ubi%d error: %s: cannot auto-resize volume %d ubi%d: volume %d ("%s") re-sized from %d to %d LEBs ubi%dubi%d error: %s: cannot add volume %d ubi%d error: %s: cannot initialize UBI %s, error %d ubi%d error: %s: cannot spawn "%s", error %d ubi%d: attached mtd%d (name "%s", size %llu MiB) ubi%d: PEB size: %d bytes (%d KiB), LEB size: %d bytes ubi%d: min./max. I/O unit sizes: %d/%d, sub-page size %d ubi%d: VID header offset: %d (aligned %d), data offset: %d ubi%d: good PEBs: %d, bad PEBs: %d, corrupted PEBs: %d ubi%d: user volume: %d, internal volumes: %d, max. volumes count: %d ubi%d: max/mean erase counter: %d/%d, WL threshold: %d, image sequence number: %u ubi%d: available PEBs: %d, total reserved PEBs: %d, PEBs reserved for bad PEB handling: %d ubi%d error: %s: %s reference count %d, destroy anyway ubi%d: detaching mtd%d ubi%d: mtd%d is detached UBI error: too many MTD devices, maximum is %d UBI error: cannot open mtd %s, error %d UBI error: cannot attach mtd%d UBI error: cannot initialize UBI, error %d UBI error: too many parameters, max. is %d UBI error: parameter "%s" is too long, max. is %d UBI error: too many arguments at "%s" UBI error: incorrect bytes count: "%s" UBI error: bad value for max_beb_per1024 parameter: %sUBI error: bad value for ubi_num parameter: %subi%d error: %s: bad CRC at record %u: %#08x, not %#08x ubi%d error: %s: bad data_pad, has to be %d ubi%d error: %s: too large reserved_pebs %d, good PEBs %d ubi%d error: %s: volumes %d and %d have the same name "%s" ubi%d error: %s: volume table check failed: record %d, error %d ubi%d error: %s: self-check failed drivers/mtd/ubi/vtbl.cubi%d error: %s: the layout volume was not found ubi%d error: %s: too many LEBs (%d) in layout volume ubi%d: volume table was restored ubi%d error: %s: both volume tables are corrupted ubi%d error: %s: more than one auto-resize volume (%d and %d) layout volumeubi%d error: %s: not enough PEBs, required %d, available %d ubi%d error: %s: %d PEBs are corrupted and not used ubi%d error: %s: found %d volumes while attaching, maximum is %d + %d ubi%d error: %s: too large volume ID %d found ubi%d: finish volume %d removal ubi%d error: %s: bad attaching information, error %d ubi%d error: %s: no volume info, but volume exists ubi%d error: %s: self-check failed for volume %d ubi%d error: %s: bad alignment ubi%d error: %s: alignment is not multiple of min I/O unit ubi%d error: %s: bad data_pad, has to be %lld ubi%d error: %s: update marker and corrupted simultaneously ubi%d error: %s: too large reserved_pebs ubi%d error: %s: bad usable_leb_size, has to be %lld ubi%d error: %s: too long volume name, max is %d ubi%d error: %s: bad name_len %lld ubi%d error: %s: corrupted dynamic volume ubi%d error: %s: bad used_ebs ubi%d error: %s: bad last_eb_bytes ubi%d error: %s: bad used_bytes ubi%d error: %s: bad skip_check ubi%d error: %s: volume info is different ubi%d error: %s: volume %d already exists ubi%d error: %s: volume "%s" exists (ID %d) ubi%d error: %s: not enough PEBs, only %d available ubi%d error: %s: cannot create volume %d, error %d ubi%d error: %s: out of volume IDs ubi%d error: %s: too small size %d, %d LEBs contain data ubi%d error: %s: not enough PEBs: requested %d, available %d ubi%d error: %s: cannot open device %d, volume %d, error %d ubi%d: force data checking ubi%d: recover PEB %d, move data to PEB %d ubi%d: data was successfully recovered ubi%d: try again ubi%d: try another PEB ubi%d error: %s: no enough physical eraseblocks (%d, need %d) ubi%d error: %s: node with incompatible UBI version found: this UBI version is %d, image version is %d ubi%d error: %s: bad VID header offset %d, expected %d ubi%d error: %s: bad data offset %d, expected %d ubi%d error: %s: bad erase counter %lld ubi%d error: %s: bad EC header ubi%d error: %s: bad magic %#08x, must be %#08x ubi%d error: %s: self-check failed for PEB %d ubi%d error: %s: bad copy_flag ubi%d error: %s: bad compat ubi%d error: %s: zero used_ebs ubi%d error: %s: zero data_size ubi%d error: %s: bad data_size ubi%d error: %s: too high lnum ubi%d error: %s: non-zero data CRC ubi%d error: %s: non-zero data_size ubi%d error: %s: zero data_size of copy ubi%d error: %s: bad VID header ubi%d error: %s: bad VID header magic %#08x at PEB %d, must be %#08x ubi%d error: %s: error %d while checking if PEB %d is bad (ECC error)ubi%d: fixable bit-flip detected at PEB %d ubi%d error: %s: error %d%s while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: bad CRC, calculated %#08x, read %#08x ubi%d error: %s: read-only mode ubi%d error: %s: cannot mark PEB %d bad, error %d ubi%d error: %s: validation failed for PEB %d ubi%d error: %s: cannot allocate memory to check for 0xFFs ubi%d error: %s: err %d while reading %d bytes from PEB %d:%d, read %zd bytes ubi%d error: %s: flash region at PEB %d:%d, length %d does not contain all 0xFF bytes ubi%d: hex dump of the %d-%d region ubi%d error: %s: bad VID header CRC at PEB %d, calculated %#08x, read %#08x ubi%d error: %s: cannot write %d bytes to PEB %d:%d (emulated) ubi%d error: %s: cannot allocate memory to check writes ubi%d error: %s: self-check failed for PEB %d:%d, len %d ubi%d: data differ at position %d ubi%d: hex dump of the original buffer from %d to %d ubi%d: hex dump of the read buffer from %d to %d ubi%d error: %s: error %d while writing %d bytes to PEB %d:%d, written %zd bytes ubi%d error: %s: cannot erase PEB %d, error %d ubi%d error: %s: cannot erase PEB %d ubi%d error: %s: cannot erase PEB %d (emulated) ubi%d error: %s: cannot invalidate PEB %d, write returned %d ubi%d: run torture test for PEB %d ubi%d error: %s: erased PEB %d, but a non-0xFF byte found ubi%d error: %s: pattern %x checking failed for PEB %d ubi%d: PEB %d passed torture test, do not mark it as bad ubi%d error: %s: read problems on freshly erased PEB %d, must be bad ubi%d error: %s: work failed with error code %d ubi%d error: %s: self-check failed for PEB %d, EC %d, Protect queue ubi%d error: %s: self-check failed for PEB %d, EC %d, RB-tree %p ubi%d error: %s: %s: work failed with error code %d ubi%d error: %s: read EC is %lld, should be %d ubi%d error: %s: erase counter overflow at PEB %d, EC %llu ubi%d error: %s: failed to erase PEB %d, error %d ubi%d error: %s: bad physical eraseblock %d detected ubi%d error: %s: no reserved/available physical eraseblocks ubi%d: mark PEB %d as bad ubi%d: %d PEBs left in the reserve ubi%d error: %s: error %d while reading VID header from PEB %d ubi%d error: %s: too many erroneous eraseblocks (%d) ubi%d: scrubbed PEB %d (LEB %d:%d), data moved to PEB %d ubi%d error: %s: error %d while moving PEB %d to PEB %d ubi%d error: %s: error %d while moving PEB %d (LEB %d:%d) to PEB %d ubi%d error: %s: PEB %d not found ubi%d: schedule PEB %d for scrubbing ubi_bgt%ddubi%d error: %s: new PEB %d does not contain all 0xFF bytes ubi%d: reserved more %d PEBs for bad PEB handling ubi%d: dumping %d bytes of data from PEB %d, offset %d Erase counter header dump: magic %#08x version %d ec %llu vid_hdr_offset %d data_offset %d image_seq %d hdr_crc %#08x erase counter header hexdump: Volume identifier header dump: magic %08x version %d vol_type %d copy_flag %d compat %d vol_id %d lnum %d data_size %d used_ebs %d data_pad %d sqnum %llu hdr_crc %08x Volume identifier header hexdump: Volume information dump: vol_id %d reserved_pebs %d alignment %d data_pad %d vol_type %d name_len %d usable_leb_size %d used_ebs %d used_bytes %lld last_eb_bytes %d corrupted %d upd_marker %d skip_check %d name %s 1st 5 characters of name: %c%c%c%c%c Volume table record %d dump: name NULL crc %#08x Volume attaching information dump: vol_id %d highest_lnum %d leb_count %d compat %d vol_type %d used_ebs %d last_data_size %d data_pad %d eraseblock attaching information dump: ec %d pnum %d lnum %d scrub %d sqnum %llu Err..(%s) Dropping packet spread on multiple descriptors Err..(%s) Dropping packet with errors Non-aligned data too large (%d) Err..(%s) in xmit packet marvell,kirkwood-eth-portfixed-linkfull-duplexFailed to allocate MDIO bus Error: SMI busy timeout Err..(%s) Invalid PHY address %d Err..(%s) Invalid register offset %d Err..(%s) SMI read ready timeout Err..(%s) Invalid phy address Err..(%s) Invalid register offset phy_connect failed mvgbemarvell,kirkwood-ethncipncoutportncinportnc(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYCannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted clock-frequencytick-timerorion_timermarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timerError: RTC did not increment. Warning: Only century %d supported. Error: RTC in 12 hour mode, can't determine AM/PM. rtc-mvmarvell,kirkwood-rtcmarvell,orion-rtcusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d No working controllers found usb_dev_genericu-boot,bootdev-usbEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. Timeout destroying interrupt endpoint queue %s: xfers requiring several transactions are not supported. Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x marvell,armada-3700-ehcimarvell,ac5-ehciehci_mvebumarvell,orion-ehcienv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s autostart*** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksreadenv() failedFAILED! NANDErasing %s... Writing to %s... ** Reading file would overwrite reserved memory ** %s/ %s %8lld %s %d file(s), %d dir(s) Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (fatext4ubifsunsupported** Can not find directory. ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s < ? > %10u %s Error: Invalid FAT entry: 0x%08x FAT32 FAT12 FAT16 Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) UNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02Xget_fl_mem: unknown device type, using raw offset! ** ERROR ** %*.*s has dup version =%s %08x find_inode failed for name=add_node: malloc failed add_node failed! xwr%.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> Scanning JFFS2 FS: offset %08x already seen, skip . OOPS Cleanmarker has bad size %d != %zu OOPS Padding has bad size %d < %zu Unknown node type: %x len %d offset 0x%x %s: Failed to scan JFFSv2 file structure  done. ls: Failed to scan jffs2 file structure load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure UNKNOWN COMPRESSION METHOD = load: Failed to read inode Compression: %s frag count: %d compressed sum: %d uncompressed sum: %d NONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIB%s: Error, no memory for malloc! Symlink recursion, aborting %s/%sUBIFS error (ubi%d:%d pid %d): %s: invalid compression type %d UBIFS error (ubi%d:%d pid %d): %s: %s compression is not compiled in UBIFS error (ubi%d:%d pid %d): %s: cannot decompress %d bytes, compressor %s, error %d UBIFS error (ubi%d:%d pid %d): %s: bad data node (block %u, inode %lu) other %s: Error in ubifs_iget(), ino=%lld ret=%p! %9lld %24.24s UBIFS error (ubi%d:%d pid %d): %s: cannot find next direntry, error %d %s: Error reading inode %ld! ubifs: Error offset must be a multiple of %d ubifs: Error offset (%lld) > file-size (%lld) %s: Error, malloc fails! UBIFS error (ubi%d:%d pid %d): %s: cannot read page %lu of inode %lu, error %d Error reading file '%s' Loading file '%s' to addr 0x%08lx... Done Unmounting UBIFS volume %s! zlibdeflateUBIFS error (ubi%d:%d pid %d): %s: reading %d bytes from LEB %d:%d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: unmap LEB %d failed, error %d UBIFS error (ubi%d:%d pid %d): %s: ubi_is_mapped failed for LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad magic %#08x, expected %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node type %d UBIFS error (ubi%d:%d pid %d): %s: bad CRC: calculated %#08x, read %#08x UBIFS error (ubi%d:%d pid %d): %s: bad node length %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node type (%d but expected %d) UBIFS error (ubi%d:%d pid %d): %s: expected node type %d UBIFS error (ubi%d:%d pid %d): %s: bad node length %d, expected %d UBIFS error (ubi%d:%d pid %d): %s: bad node at LEB %d:%d, LEB mapping status %d UBIFS error (ubi%d:%d pid %d): %s: orphan list not empty at unmount UBIFS error (ubi%d:%d pid %d): %s: inode is too large (%lld) UBIFS error (ubi%d:%d pid %d): %s: unknown compression type %d UBIFS error (ubi%d:%d pid %d): %s: inode %lu validation failed, error %d UBIFS error (ubi%d:%d pid %d): %s: failed to read inode %lu, error %d UBI volumeUBIFS error (pid: %d): cannot open "%s", error %d UBIFS: only ro mode in U-Boot allowed. UBIFS error (ubi%d:%d pid %d): %s: too small LEBs (%d bytes), min. is %d bytes UBIFS error (ubi%d:%d pid %d): %s: too few LEBs (%d), min. is %d UBIFS error (ubi%d:%d pid %d): %s: bad min. I/O size %d UBIFS error (ubi%d:%d pid %d): %s: bad write buffer size %d for %d min. I/O unit UBIFS error (ubi%d:%d pid %d): %s: can't format empty UBI volume: read-only %s UBIFS error (ubi%d:%d pid %d): %s: cannot mount read-write - read-only media UBIFS error (ubi%d:%d pid %d): %s: 'compressor "%s" is not compiled in UBIFS error (ubi%d:%d pid %d): %s: too small LEB size %d, at least %d needed UBIFS error (ubi%d:%d pid %d): %s: too small log %d LEBs, required min. %d LEBs ubifs_bgt%d_%dUBIFS error (ubi%d:%d pid %d): %s: no LEB for GC Error reading superblock on volume '%s' errno=%d! No UBIFS filesystem found! UBIFS error (ubi%d:%d pid %d): %s: on-flash format version is w%d/r%d, but software only supports up to version w%d/r%d UBIFS error (ubi%d:%d pid %d): %s: on-flash format version %d is not supported UBIFS error (ubi%d:%d pid %d): %s: unsupported key format UBIFS error (ubi%d:%d pid %d): %s: min. I/O unit mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: LEB size mismatch: %d in superblock, %d real UBIFS error (ubi%d:%d pid %d): %s: bad LEB count: %d in superblock, %d on UBI volume, %d minimum required UBIFS error (ubi%d:%d pid %d): %s: max. LEB count %d less than LEB count %d UBIFS error (ubi%d:%d pid %d): %s: too small journal (%lld bytes), must be at least %lld bytes UBIFS error (ubi%d:%d pid %d): %s: too large journal size (%lld bytes), only %lld bytes available in the main area UBIFS error (ubi%d:%d pid %d): %s: bad superblock, error %d UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d master LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad leb_cnt on master node UBIFS error (ubi%d:%d pid %d): %s: bad master node at offset %d error %d UBIFS error (ubi%d:%d pid %d): %s: too few LPT LEBs UBIFS error (ubi%d:%d pid %d): %s: LPT ltab too big UBIFS error (ubi%d:%d pid %d): %s: invalid crc in LPT node: crc %hx calc %hx UBIFS error (ubi%d:%d pid %d): %s: invalid type (%d) in LPT node type %d UBIFS error (ubi%d:%d pid %d): %s: error %d reading nnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: error %d reading pnode at %d:%d UBIFS error (ubi%d:%d pid %d): %s: calc num: %d UBIFS error (ubi%d:%d pid %d): %s: bad pad node at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad padding length %d - %d UBIFS error (ubi%d:%d pid %d): %s: cannot read %d bytes from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: corruption at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first %d bytes from LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: garbage UBIFS error (ubi%d:%d pid %d): %s: bad node UBIFS error (ubi%d:%d pid %d): %s: unknown UBIFS error (ubi%d:%d pid %d): %s: empty space starts at non-aligned offset %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed UBIFS error (ubi%d:%d pid %d): %s: LEB %d scanning failed, error %d UBIFS error (ubi%d:%d pid %d): %s: cannot change properties of LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: cannot update properties of LEB %d, error %d UBIFS error (ubi%d:%d pid %d): %s: old idx added twice! UBIFS error (ubi%d:%d pid %d): %s: cannot read node type %d from LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: current fanout %d, branch count %d UBIFS error (ubi%d:%d pid %d): %s: max levels %d, znode level %d UBIFS error (ubi%d:%d pid %d): %s: bad branch %d UBIFS error (ubi%d:%d pid %d): %s: bad key type at slot %d: %d UBIFS error (ubi%d:%d pid %d): %s: bad target node (type %d) length (%d) UBIFS error (ubi%d:%d pid %d): %s: have to be %d UBIFS error (ubi%d:%d pid %d): %s: have to be in range of %d-%d UBIFS error (ubi%d:%d pid %d): %s: bad key order (keys %d and %d) UBIFS error (ubi%d:%d pid %d): %s: keys %d and %d are not hashed but equivalent UBIFS error (ubi%d:%d pid %d): %s: bad indexing node at LEB %d:%d, error %d UBIFS error (ubi%d:%d pid %d): %s: bad key in node at LEB %d:%d (%lu, %s)inode(%lu, %s, %#08x)(%lu, %s, %u)datatruncate(bad key type: %#08x, %#08x)bad key format %dunknown nodeunknownR5unknown/invalid name hashsimpleunknown/invalid formatNot a node, first %zu bytes: magic %#x crc %#x node_type %d (%s) group_type %d (%s) sqnum %llu len %u pad_len %u key_hash %d (%s) key_fmt %d (%s) flags %#x big_lpt %u space_fixup %u min_io_size %u leb_size %u leb_cnt %u max_leb_cnt %u max_bud_bytes %llu log_lebs %u lpt_lebs %u orph_lebs %u jhead_cnt %u fanout %u lsave_cnt %u default_compr %u rp_size %llu rp_uid %u rp_gid %u fmt_version %u time_gran %u UUID %pUB highest_inum %llu commit number %llu log_lnum %u root_lnum %u root_offs %u root_len %u gc_lnum %u ihead_lnum %u ihead_offs %u index_size %llu lpt_lnum %u lpt_offs %u nhead_lnum %u nhead_offs %u ltab_lnum %u ltab_offs %u lsave_lnum %u lsave_offs %u lscan_lnum %u empty_lebs %u idx_lebs %u total_free %llu total_dirty %llu total_used %llu total_dead %llu total_dark %llu lnum %u offs %u jhead %u key %s creat_sqnum %llu size %llu nlink %u atime %lld.%u mtime %lld.%u ctime %lld.%u uid %u gid %u mode %u xattr_cnt %u xattr_size %u xattr_names %u compr_type %#x data len %u inum %llu type %d nlen %d name (bad name length, not printing, bad or corrupted node) size %u compr_typ %d data size %d data: inum %u old_size %llu new_size %llu child_cnt %d level %d Branches: %d: LEB %d:%d len %d key %s last node flag %llu %d orphan inode numbers: ino %llu node type %d was not recognized znode %p, LEB %d:%d len %d parent %p iip %d level %d child_cnt %d flags %lx zbranches: %d: znode %p LEB %d:%d len %d key %s %d: LNC %p LEB %d:%d len %d key %s (pid %d) dumping pnode: address %zx parent %zx cnext %zx flags %lu iip %d level %d num %d %d: free %d dirty %d flags %d lnum %d not categorizeddirtyfreeemptyfreeable0 (GC)1 (base)2 (data)commit restingbackground commit requestedcommit requiredBACKGROUND commit runningcommit running and requiredbroken commitinode nodedata nodedirentry nodexentry nodetruncate nodepadding nodesuperblock nodemaster nodereference nodeindexing nodecommit start nodeorphan nodeno node groupin node grouplast of node groupdirentryxentryUBIFS error (ubi%d:%d pid %d): %s: invalid node type %d in orphan area at %d:%d UBIFS error (ubi%d:%d pid %d): %s: out of order commit number %llu in orphan node at %d:%d UBIFS error (ubi%d:%d pid %d): %s: failed to recover master node UBIFS error (ubi%d:%d pid %d): %s: dumping first master node UBIFS error (ubi%d:%d pid %d): %s: dumping second master node UBIFS error (ubi%d:%d pid %d): %s: unexpected return value %d UBIFS error (ubi%d:%d pid %d): %s: corrupt empty space LEB %d:%d, corruption starts at %d UBIFS error (ubi%d:%d pid %d): %s: corruption %d UBIFS error (ubi%d:%d pid %d): %s: Not a valid node UBIFS error (ubi%d:%d pid %d): %s: Node a CS node, type is %d UBIFS error (ubi%d:%d pid %d): %s: CS node cmt_no %llu != current cmt_no %llu UBIFS error (ubi%d:%d pid %d): %s: failed to get CS sqnum UBIFS error (ubi%d:%d pid %d): %s: unrecoverable log corruption in LEB %d directory entryextended attribute entryUBIFS error (ubi%d:%d pid %d): %s: bad %s node UBIFS error (ubi%d:%d pid %d): %s: bad key type %d UBIFS error (ubi%d:%d pid %d): %s: bad index head LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: first log node at LEB %d:%d is not CS node UBIFS error (ubi%d:%d pid %d): %s: first CS node at LEB %d:%d has wrong commit number %llu expected %llu UBIFS error (ubi%d:%d pid %d): %s: first node is not at zero offset UBIFS error (ubi%d:%d pid %d): %s: file system's life ended UBIFS error (ubi%d:%d pid %d): %s: bad sqnum %llu, commit sqnum %llu UBIFS error (ubi%d:%d pid %d): %s: bud at LEB %d:%d was already referred UBIFS error (ubi%d:%d pid %d): %s: unexpected node in log UBIFS error (ubi%d:%d pid %d): %s: log error detected while replaying the log at LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: no UBIFS nodes found at the log head LEB %d:%d, possibly corrupted UBIFS error (ubi%d:%d pid %d): %s: bad truncation node UBIFS error (ubi%d:%d pid %d): %s: unexpected node type %d in bud LEB %d:%d UBIFS error (ubi%d:%d pid %d): %s: bad node is at LEB %d:%d ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part BZIP2 internal error %d list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsNo valid device tree binary found at %p okayseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\Could not initialize timer (err %d) Could not read count from timer (err %d) ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armbootp_archbootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address DT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. ethactethrotatenoethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskipnetretryyesonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set NFSCannot autoload with NFS Cannot autoload with TFTPGET Abort Bytes transferred = %d (%x hex) %d.%d.%d.%dnvlan*** ERROR: NFS version not supported *** ERROR: Cannot mount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx SunMonTueWedThuFriSatSunMonTueWedThuFriSatbootcmd=setenv bootargs ${console} ${mtdparts} ${bootargs_root}; ubi part root; ubifsmount ubi:rootfs; ubifsload 0x800000 ${kernel}; ubifsload 0x700000 ${fdt}; ubifsumount; fdt addr 0x700000; fdt resize; fdt chosen; bootz 0x800000 - 0x700000bootdelay=3baudrate=115200loadaddr=0x800000mtdids=nand0=orion_nandmtdparts=mtdparts=orion_nand:896K(uboot),128K(uboot_env),-@1M(root)console=console=ttyS0,115200mtdids=nand0=orion_nandkernel=/boot/zImagefdt=/boot/guruplug-server-plus.dtbbootargs_root=ubi.mtd=2 root=ubi0:rootfs rootfstype=ubifs rw0123456789ABCDEFarocsdxbim 0123456789abcdef     LZO  JanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunJulAugSepOctNovDecEPTGMKUVY ZZ YVUe03f] - Run script starting at addrf`ax`ggf`aPx`gg[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead  /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.@ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand'|'spi-nand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw[.noverify] - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off bit - make a bit error at offset and bit position (UNSAFE).'g`a`ggaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] f`a/agg8Dg `a)agg?Dg`a1aggDDg`a<3aggKDg`a\,aggRDg @a+aggAg @aaggXDg`aX*aggRg `a2agg]Dg`a/aggzfdFg8iFgnFg fsFgwFg }Fg &g Fg Fg ^a^aD`a4`a^aT`a`ax^al`a\`a`a``ad`aaܰc|`a_aL`at`al_a _a^aa5aa`l `^a^ahhhhhhhhhh h hhhhh$h$h,h,h4h4h<h<hDhDhLhLhThTh\h\hdhdhlhlhthth|h|hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h hhhhh$h$h,h,h4h4h<h<hDhDhLhLhThTh\h\hdhdhlhlhthth|h|hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h hhhhh$h$h,h,h4h4h<h<hDhDhLhLhThTh\h\hdhdhlhlhthth|h|hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh h hhhhh$h$h,h,h4h4h<h<hDhDhLhLhThTh\h\hdhdhlhlhthth|h|hhhhhhhhhhhhhhhhhhhhhhhhhhhRgRgRgp ThTh^g#h#h# h# h1tbBBbt0,fglgTlg>jlg.lgN0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&eserial0ccHcCͼ-}wp4mG0K=V9'C#=.r *ϝxO K} xV|iqލuݓklRobfF^[^Z}Wf`Sc0M-ZI D@ƥ d'NK`%#/+6lA/ ]D@hf+*{Pu&6>;;kvqUP2M_}1>φ˃4y:Z iYmێ`7Od2z~\sKwV OK86F+GB{\=fX@US]CQ;%)&!,G^(BM6P2,v?kZ;&H VM#RV/K`mpl +e= hﶻ'؀odj#ͳ`~>ɐ}:{y`6q}[Fu2 t-0q].KYT@PENOJ+ GC!}{`COFr[v hJGl0a$-eK^VZp0m5= ^[ Q7R3?>:З$:V -T)y&;h+̠ȥPMlk/|vˡv`#ds'ě yg:Ջb}>  q+2h6mf{u]6@k0-6_[Om>Ic3n+ecc1^'Oo;{mqi_IzOU!jrRd!3M\cX~Twb)bUfXDu&6(GwCji \0BO$`>a[p_#^]bc4aDOrvoQr} ,5NWN`~YfkD|Rdpk)w4X^QX%.Nq}E) f3&bwA@ir~o<8.);W8V^l;lw0IWa:v6Il1l=RWq&'; $z<P5+R?# %85e&`z=jnt7& {drY 2lrefRZl~Xdhg@a&a?gh g`al`g4gg`aܦ`g gg`a`ggg`aܦ`kg grg`aܦ`g gg@a` g" gLf@a`B gQ g{g@a$`ggu`g@a|` g g g@a(` g g,g`a`g h g@a`` g gg @a`&g h>&g@a`D&gZ&g3Jg@a(`'g'gk'g@apao'g'g g@aD` g gSf@aTp`Yfuf3'g@aX`8'g_'g)Cg @a+a2CgNCga g @ap`fgvf`a`|ffAg @aaBg)BgadDg`aX*alDggAg `a2aoBgBgaEg @a8aEgEgog@a`uggf`a@u`f*g g @aa(g(g'g@aXa'g'g](g @aab(ge/g@a ai/gv/g3g`aa3g4gW4g`aa_4gy4g4g`a a4g4g4g`a|a4g4gg@a"a:g:g:g@a"a:gff@alp`fgYgPpfOfXfb`Dg ff\_`x_`L_`0 gxfcc@HVh gHfTf\dhN]g9b]g@f]gPf b@hȠg(fdc`c8fguHfchf^gJgdTfclf_ghf`0@`4@`H@`L@``@`d@`A`A`A` A`A`A`A`A`A`A`A`bh>b>b>b?b@b@b@b@b@b0Gb8GbQ _qs disabledocp@f1000000 simple-bus pin-controller@10000o marvell,88f6281-pinctrlpmx-ge1Hmpp20mpp21mpp22mpp23mpp24mpp25mpp26mpp27mpp30mpp31mpp32mpp33ge1 pmx-nand*mpp0mpp1mpp2mpp3mpp4mpp5mpp18mpp19nandpmx-spimpp0mpp1mpp2mpp3spipmx-twsi0 mpp8mpp9twsi0pmx-uart0 mpp10mpp11uart0pmx-uart1 mpp13mpp14uart1 pmx-sata0mpp5mpp21mpp23sata0pmx-sata1mpp4mpp20mpp22sata1pmx-sdio$mpp12mpp13mpp14mpp15mpp16mpp17sdiopmx-led-health-rmpp46gpiopmx-led-health-gmpp47gpiopmx-led-wmode-rmpp48gpiopmx-led-wmode-gmpp49gpiocore-clocks@10030marvell,kirkwood-core-clocko0spi@10600marvell,orion-spio(sdefault disabledgpio@10100marvell,orion-gpioo@ -#$%&sgpio@10140marvell,orion-gpioo@@- '()si2c@11000marvell,mv64xxx-i2co sdefault disabledserial@12000 ns16550ao  !sdefaultokserial@12100 ns16550ao! "s default disabledmbus-controller@20000marvell,mbus-controllero system-controller@20000 marvell,orion-system-controllero bridge-interrupt-ctrl@20110marvell,orion-bridge-intc-o clock-gating-control@2011cmarvell,kirkwood-gating-clockosl2-cache@20128marvell,kirkwood-cacheo(main-interrupt-ctrl@20200marvell,orion-intc-otimer@20300marvell,orion-timero & swatchdog-timer@20300marvell,orion-wdto(& sokaycrypto@30000marvell,kirkwood-cryptoo*regss4 Iokayehci@50000marvell,orion-ehciosokayxor@60800marvell,orion-xoro okaysxor00bpxor01bp{xor@60900marvell,orion-xoro  okaysxor00bpxor01bp{ethernet-controller@72000marvell,kirkwood-etho @s@okayethernet0-port@0marvell,kirkwood-eth-porto   rgmii-idmdio-bus@72004marvell,orion-mdioo .sokayethernet-phy@04ethernet-phy-id0141.0cb0ethernet-phy-ieee802.3-c22o ethernet-phy@14ethernet-phy-id0141.0cb0ethernet-phy-ieee802.3-c22oethernet-controller@76000marvell,kirkwood-etho`@s@ defaultokayethernet1-port@0marvell,kirkwood-eth-porto rgmii-idsata-phy@82000marvell,mvebu-sata-phyo 4szsataoksata-phy@84000marvell,mvebu-sata-phyo@4szsataokaudio-controller@a0000marvell,kirkwood-audioo "s  zinternal disabledrtc@10300'marvell,kirkwood-rtcmarvell,orion-rtco 5ssata@80000marvell,orion-sataoPsz01 port0port1okaymvsdio@90000marvell,orion-sdioo sdefault0okayBgpio-leds gpio-ledsdefaulthealth-rguruplug:red:health health-gguruplug:green:health wmode-rguruplug:red:wmode wmode-gguruplug:green:wmode  #address-cells#size-cellscompatibleinterrupt-parentmodelbootargsstdout-pathgpio0gpio1i2c0device_typeregclocksclock-namesrangescontrollerpcie-mem-aperturepcie-io-apertureclealebank-widthchip-delaypinctrl-0pinctrl-namesstatuslabelread-onlyphandlebus-rangeassigned-addresses#interrupt-cellsinterrupt-map-maskinterrupt-mapmarvell,pcie-portmarvell,pcie-lanemarvell,pinsmarvell,function#clock-cellscell-indexinterrupts#gpio-cellsgpio-controllerngpiosinterrupt-controllerclock-frequencyreg-shiftmarvell,#interruptsreg-namesmarvell,crypto-sramsmarvell,crypto-sram-sizedmacap,memcpydmacap,xordmacap,memsetmarvell,tx-checksum-limitlocal-mac-addressphy-handlephy-connection-type#phy-cells#sound-dai-cellsphysphy-namesnr-portsbus-widthcap-sdio-irqcap-sd-highspeedcap-mmc-highspeednon-removable31