This R package makes use of the exhaustive RESTful Web service API that has been implemented for the Cellabase database. It enable researchers to query and obtain a wealth of biological information from a single database saving a lot of time. Another benefit is that researchers can easily make queries about different biological topics and link all this information together as all information is integrated.
This is an S4 class that holds the basic configuration for connecting to the Cellbase web services. Let us start by loading the library.
The cellbaseR package provide many methods to query the cellbase webservices, they include:
In all cases the user is expected to provide the ids for the query and the resource to be queried, in addition to the CellbaseQuery object they created. For example, a query through the cbGene will look something like this
library(cellbaseR)
cb <- CellBaseR()
genes <- c("TP73","TET1")
res <- getGene(object = cb, ids = genes, resource = "info")
str(res,2)## 'data.frame': 1 obs. of 13 variables:
## $ id : chr "ENSG00000078900"
## $ name : chr "TP73"
## $ chromosome : chr "1"
## $ start : int 3652516
## $ end : int 3736201
## $ strand : chr "+"
## $ biotype : chr "protein_coding"
## $ status : chr "KNOWN"
## $ source : chr "ensembl"
## $ version : chr "15"
## $ description: chr "tumor protein p73 [Source:HGNC Symbol;Acc:HGNC:12003]"
## $ transcripts:List of 1
## ..$ :'data.frame': 14 obs. of 23 variables:
## $ annotation :'data.frame': 1 obs. of 5 variables:
## ..$ expression :List of 1
## ..$ diseases :List of 1
## ..$ drugs :List of 1
## ..$ constraints :List of 1
## ..$ mirnaTargets:List of 1
# as you can see the res dataframe also contains a transcripts column
# which is in fact a list column of nested dataframes, to get the
# trasnscripts data.frame for first gene
TET1_transcripts <- res$transcripts[[1]]
str(TET1_transcripts,1)## 'data.frame': 14 obs. of 23 variables:
## $ id : chr "ENST00000378295.9" "ENST00000604074.5" "ENST00000354437.8" "ENST00000603362.5" ...
## $ name : chr "TP73-208" "TP73-211" "TP73-202" "TP73-209" ...
## $ chromosome : chr "1" "1" "1" "1" ...
## $ start : int 3652516 3652520 3652565 3682366 3682366 3690672 3690672 3690672 3690707 3698046 ...
## $ end : int 3736201 3736201 3733292 3733079 3733079 3733292 3733292 3736201 3729751 3708534 ...
## $ strand : chr "+" "+" "+" "+" ...
## $ biotype : chr "protein_coding" "protein_coding" "protein_coding" "protein_coding" ...
## $ status : chr "KNOWN" "KNOWN" "KNOWN" "KNOWN" ...
## $ genomicCodingStart: int 3682366 3682366 3682366 3682366 3682366 3690906 3690906 3690906 0 0 ...
## $ genomicCodingEnd : int 3733079 3732762 3732762 3733079 3733079 3732762 3731555 3733079 0 0 ...
## $ cdnaCodingStart : int 160 156 111 1 1 235 235 235 0 0 ...
## $ cdnaCodingEnd : int 2070 1367 1610 1668 1623 1587 1515 1998 0 0 ...
## $ cdsLength : int 1910 1211 1499 1667 1622 1352 1280 1763 0 0 ...
## $ cdnaSequence : chr "GCCCTGCCTCCCCGCCCGCGCACCCGCCCGGAGGCTCGCGCGCCCGCGAAGGGGACGCAGCGAAACCGGGGCCCGCGCCAGGCCAGCCGGGACGGACGCCGATGCCCGGGG"| __truncated__ "TGCCTCCCCGCCCGCGCACCCGCCCGGAGGCTCGCGCGCCCGCGAAGGGGACGCAGCGAAACCGGGGCCCGCGCCAGGCCAGCCGGGACGGACGCCGATGCCCGGGGCTGC"| __truncated__ "AGGGGACGCAGCGAAACCGGGGCCCGCGCCAGGCCAGCCGGGACGGACGCCGATGCCCGGGGCTGCGACGGCTGCAGAGCGAGCTGCCCTCGGAGGCCGGCGTGGGGAAGA"| __truncated__ "ATGGCCCAGTCCACCGCCACCTCCCCTGATGGGGGCACCACGTTTGAGCACCTCTGGAGCTCTCTGGAACCAGACAGCACCTACTTCGACCTTCCCCAGTCAAGCCGGGGG"| __truncated__ ...
## $ proteinId : chr "ENSP00000367545.4" "ENSP00000475143.1" "ENSP00000346423.4" "ENSP00000474626.1" ...
## $ proteinSequence : chr "MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSP"| __truncated__ "MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSP"| __truncated__ "MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSP"| __truncated__ "MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSP"| __truncated__ ...
## $ version : chr "9" "5" "8" "5" ...
## $ source : chr "ensembl" "ensembl" "ensembl" "ensembl" ...
## $ exons :List of 14
## $ xrefs :List of 14
## $ tfbs :List of 14
## $ flags :List of 14
## $ annotation :'data.frame': 14 obs. of 2 variables:
# making a query through cbRegion to get all the clinically relevant variants
# in a specific region
library(cellbaseR)
cb <- CellBaseR()
# to get all conservation data in this region
res <- getRegion(object=cb,ids="17:1000000-1005000",
resource="conservation")
#likewise to get all the regulatory data for the same region
res <- getRegion(object=cb,ids="17:1000000-1005000", resource="regulatory")
str(res,1)## 'data.frame': 3 obs. of 6 variables:
## $ id : chr "ENSR00000546759" "ENSR00001005684" "ENSR00001005685"
## $ chromosome : chr "17" "17" "17"
## $ start : int 998401 1001001 1003601
## $ end : int 1000000 1001200 1004000
## $ featureType: chr "CTCF_binding_site" "CTCF_binding_site" "CTCF_binding_site"
## $ cellTypes :List of 3
Getting annotation for a specific variant
library(cellbaseR)
cb <- CellBaseR()
res2 <- getVariant(object=cb, ids="1:169549811:A:G", resource="annotation")
# to get the data
res2 <- cbData(res2)
str(res2, 1)A very powerfull feature of cellbaseR is ability to fetch a wealth of clinical data, as well as abiliy to fiter these data by gene, phenotype, rs, etc…
library(cellbaseR)
cb <- CellBaseR()
# First we have to specify aour param, we do that by creating an object of
# class CellbaseParam
cbparam <- CellBaseParam(feature = "TET1", assembly = "grch38",limit=50)
cbparam## |An object of class CellBaseParam
## |use this object to control what results are returned from the CellBaseR
## methods
# Note that cbClinical does NOT require any Ids to be passed, only the param
# and of course the CellbaseQuery object
res <- getClinical(object=cb,param=cbparam)
str(res,1)## 'data.frame': 50 obs. of 17 variables:
## $ chromosome : chr "10" "10" "10" "10" ...
## $ start : int 68572584 68572590 68572598 68572667 68572848 68572948 68573149 68572384 68572573 68572735 ...
## $ reference : chr "G" "G" "C" "C" ...
## $ alternate : chr "A" "T" "G" "A" ...
## $ hgvs :List of 50
## $ displayConsequenceType: chr "missense_variant" "missense_variant" "missense_variant" "missense_variant" ...
## $ consequenceTypes :List of 50
## $ conservation :List of 50
## $ geneConstraints :List of 50
## $ geneMirnaTargets :List of 50
## $ geneCancerAssociations:List of 50
## $ traitAssociation :List of 50
## $ functionalScore :List of 50
## $ cytoband :List of 50
## $ id : chr NA NA "10:68572598:C:G" NA ...
## $ populationFrequencies :List of 50
## $ repeat :List of 50
cellbaseE package also provides many wrapper functions around commomn
cellbaseR queries. These include:
- getClinicalByGene - getTranscriptByGene - getGeneInfo - getProteinInfo
- getClinicalByRegion - getConservationByRegion - getRegulatoryByRegion
- getTfbsByRegion - getVariantAnnotation
A usefull utility for fast building of gene models, compatible with Gviz package for genomic visualization
library(cellbaseR)
cb <- CellBaseR()
cbparam <- CellBaseParam(feature = "TET1", assembly = "grch37")
test <- createGeneModel(object = cb, region = "17:1500000-1550000")
if(require("Gviz")){
testTrack <- Gviz::GeneRegionTrack(test)
Gviz::plotTracks(testTrack, transcriptAnnotation='symbol')
}This utility allows users to annoate genomic variants from small to medium-sized vcf files directly from the cellbase server, with a wealth of genomic annotations including riche clinical annotations like clinvar, gwas, and cosmic data, as well as conservation and functional scores like phast and cadd scores , without the need to download any files.
library(cellbaseR)
library(VariantAnnotation)
cb <- CellBaseR()
fl <- system.file("extdata", "hapmap_exome_chr22_200.vcf.gz",package = "cellbaseR" )
res <- AnnotateVcf(object=cb, file=fl, BPPARAM = bpparam(workers=2),batch_size = 100)
vcf <- readVcf(fl, "hg19")
samples(header(vcf))## [1] "NA07034@1099927558" "NA07048@1099927687" "NA07055@1099927615"
## [4] "NA10846@1099927836" "NA10847@1099927741" "NA12146@1099927743"
## [7] "NA12239@1099927424" "NA12877@1099925716" "NA12878@1099927697"
## [10] "NA12891@1099927856" "NA12892@1099927810" "NA18503@1099927775"
## [13] "NA18504@0178873056" "NA18505@1099927412" "NA18506@1099927650"
## [16] "NA18524@1099927756" "NA18532@1099927601" "NA18912@1099927835"
## [19] "NA18913@1099927630" "NA18914@0178874379" "NA18940@1099927867"
## [22] "NA18947@0178875080"
## [1] TRUE
## 'data.frame': 200 obs. of 19 variables:
## $ chromosome : chr "22" "22" "22" "22" ...
## $ start : int 16157603 17060707 17072347 17177682 17265124 17326914 17446991 17469049 17602839 17603503 ...
## $ reference : chr "G" "G" "C" "C" ...
## $ alternate : chr "C" "A" "T" "A" ...
## $ hgvs :List of 200
## $ displayConsequenceType: chr "intergenic_variant" "non_coding_transcript_exon_variant" "2KB_downstream_variant" "2KB_downstream_variant" ...
## $ consequenceTypes :List of 200
## $ conservation :List of 200
## $ geneTraitAssociation :List of 200
## $ geneDrugInteraction :List of 200
## $ geneConstraints :List of 200
## $ geneMirnaTargets :List of 200
## $ geneCancerAssociations:List of 200
## $ cancerHotspots :List of 200
## $ functionalScore :List of 200
## $ cytoband :List of 200
## $ repeat :List of 200
## $ id : chr NA NA NA NA ...
## $ populationFrequencies :List of 200