B. AlphaFold Integration

Original version: 31 October, 2023

Introduction

This vignette illustrates how to display AlphaMissense predictions on AlphaFold predicted protein structure.

Visualization makes use of CRAN packages bio3d and r3dmol. Install these (if necessary) with

pkgs <- c("bio3d", "r3dmol")
pkgs_to_install <- pkgs[!pkgs %in% rownames(installed.packages())]
if (length(pkgs_to_install))
    BiocManager::install(pkgs_to_install)

Start by loading the AlphaMissenseR library.

library(AlphaMissenseR)

Visit the summary of available AlphaMissense datasets

am_available()
#> # A tibble: 7 × 6
#>   record   key                             size cached filename            link 
#>   <chr>    <chr>                          <dbl> <lgl>  <chr>               <chr>
#> 1 10813168 gene_hg38                     253636 FALSE  AlphaMissense_gene… http…
#> 2 10813168 isoforms_hg38             1177361934 FALSE  AlphaMissense_isof… http…
#> 3 10813168 isoforms_aa_substitutions 2461351945 FALSE  AlphaMissense_isof… http…
#> 4 10813168 hg38                       642961469 FALSE  AlphaMissense_hg38… http…
#> 5 10813168 hg19                       622293310 FALSE  AlphaMissense_hg19… http…
#> 6 10813168 gene_hg19                     243943 FALSE  AlphaMissense_gene… http…
#> 7 10813168 aa_substitutions          1207278510 FALSE  AlphaMissense_aa_s… http…

This vignette uses the aa_substitutions and hg38 data resources; make sure that these have been cached locally.

am_data("aa_substitutions")
#> * [07:33:44][info] retrieving file name 'AlphaMissense_aa_substitutions.tsv.gz' (1.1 Gb)
#> * [07:33:44][info] data licensed under 'CC-BY-4.0'
#> * [07:33:44][info] downloading or finding local file
#> adding rname 'AlphaMissense_aa_substitutions.tsv.gz'
#> 
#> * [07:34:21][info] creating database table 'aa_substitutions'
#> * [07:34:21][info] disconnecting all registered connections
#> # Source:   table<aa_substitutions> [?? x 4]
#> # Database: DuckDB 1.4.4 [unknown@Linux 6.11.0-1018-azure:R 4.5.2//github/home/.cache/R/BiocFileCache/19673cbee2f7_19673cbee2f7]
#>    uniprot_id protein_variant am_pathogenicity am_class  
#>    <chr>      <chr>                      <dbl> <chr>     
#>  1 A0A024R1R8 M1A                        0.467 ambiguous 
#>  2 A0A024R1R8 M1C                        0.383 ambiguous 
#>  3 A0A024R1R8 M1D                        0.827 pathogenic
#>  4 A0A024R1R8 M1E                        0.524 ambiguous 
#>  5 A0A024R1R8 M1F                        0.275 benign    
#>  6 A0A024R1R8 M1G                        0.548 ambiguous 
#>  7 A0A024R1R8 M1H                        0.552 ambiguous 
#>  8 A0A024R1R8 M1I                        0.321 benign    
#>  9 A0A024R1R8 M1K                        0.288 benign    
#> 10 A0A024R1R8 M1L                        0.175 benign    
#> # ℹ more rows
am_data("hg38")
#> * [07:35:40][info] retrieving file name 'AlphaMissense_hg38.tsv.gz' (613.2 Mb)
#> * [07:35:40][info] data licensed under 'CC-BY-4.0'
#> * [07:35:40][info] downloading or finding local file
#> adding rname 'AlphaMissense_hg38.tsv.gz'
#> 
#> * [07:35:58][info] creating database table 'hg38'
#> * [07:35:58][info] disconnecting all registered connections
#> * [07:37:02][info] renaming '#CHROM' to 'CHROM' in table 'hg38'
#> # Source:   table<hg38> [?? x 10]
#> # Database: DuckDB 1.4.4 [unknown@Linux 6.11.0-1018-azure:R 4.5.2//github/home/.cache/R/BiocFileCache/19673cbee2f7_19673cbee2f7]
#>    CHROM   POS REF   ALT   genome uniprot_id transcript_id     protein_variant
#>    <chr> <dbl> <chr> <chr> <chr>  <chr>      <chr>             <chr>          
#>  1 chr1  69094 G     T     hg38   Q8NH21     ENST00000335137.4 V2L            
#>  2 chr1  69094 G     C     hg38   Q8NH21     ENST00000335137.4 V2L            
#>  3 chr1  69094 G     A     hg38   Q8NH21     ENST00000335137.4 V2M            
#>  4 chr1  69095 T     C     hg38   Q8NH21     ENST00000335137.4 V2A            
#>  5 chr1  69095 T     A     hg38   Q8NH21     ENST00000335137.4 V2E            
#>  6 chr1  69095 T     G     hg38   Q8NH21     ENST00000335137.4 V2G            
#>  7 chr1  69097 A     G     hg38   Q8NH21     ENST00000335137.4 T3A            
#>  8 chr1  69097 A     C     hg38   Q8NH21     ENST00000335137.4 T3P            
#>  9 chr1  69097 A     T     hg38   Q8NH21     ENST00000335137.4 T3S            
#> 10 chr1  69098 C     A     hg38   Q8NH21     ENST00000335137.4 T3N            
#> # ℹ more rows
#> # ℹ 2 more variables: am_pathogenicity <dbl>, am_class <chr>

AlphaFold protein structure

AlphaMissense predictions on pathogenicity of amino acid changes can be combined with AlphaFold (or other) predictions of protein structure.

Fast path

Figure 3F of the AlphaMissense publication visualizes mean pathogenicity for UniProt id P35557. Filter amino acid data for that identifier

P35557_aa <-
    am_data("aa_substitutions") |>
    dplyr::filter(uniprot_id == "P35557")

and visualization median pathogenicity with

af_prediction_view(P35557_aa)
#> adding rname 'AF-P35557-F1-model_v6.pdb'

The image is interactive, including rotation and zoom. The following sections explore this visualization in more detail.

UniProt identifiers

Both AlphaMissense and AlphaFold use UniProt identifiers. Find all AlphaMissense amino acid substitutions with UniProt identifiers starting with P3555; the choice of this identifier is so that results can be compared with Figure 3F of the AlphaMissense publication.

uniprot_ids <-
    am_data("aa_substitutions") |>
    dplyr::filter(uniprot_id %like% "P3555%") |>
    dplyr::distinct(uniprot_id) |>
    pull(uniprot_id)
uniprot_ids
#> [1] "P35556" "P35558" "P35555" "P35557"

The AlphaMissenseR package includes several functions that facilitate interaction with AlphaFold; these functions start with af_*(). Use af_predictions() to discover AlphaFold predictions (via the AlphaFold API) associated with UniProt identifiers.

prediction <- af_predictions(uniprot_ids)
#> * [07:37:04][info] 1 of 4 uniprot accessions not found
#>   'P35555'
glimpse(prediction)
#> Rows: 2
#> Columns: 39
#> $ toolUsed                   <chr> "AlphaFold Monomer v2.0 pipeline", "AlphaFo…
#> $ providerId                 <chr> "GDM", "GDM"
#> $ entityType                 <chr> "protein", "protein"
#> $ isUniProt                  <lgl> TRUE, TRUE
#> $ modelEntityId              <chr> "AF-P35558-F1", "AF-P35557-F1"
#> $ modelCreatedDate           <chr> "2025-08-01T00:00:00Z", "2025-08-01T00:00:0…
#> $ sequenceVersionDate        <chr> "2006-03-07T00:00:00Z", "1994-06-01T00:00:0…
#> $ globalMetricValue          <dbl> 96.44, 93.69
#> $ fractionPlddtVeryLow       <dbl> 0.003, 0.002
#> $ fractionPlddtLow           <dbl> 0.011, 0.019
#> $ fractionPlddtConfident     <dbl> 0.048, 0.133
#> $ fractionPlddtVeryHigh      <dbl> 0.937, 0.845
#> $ latestVersion              <int> 6, 6
#> $ allVersions                <list> [1, 2, 3, 4, 5, 6], [1, 2, 3, 4, 5, 6]
#> $ sequence                   <chr> "MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDH…
#> $ sequenceStart              <int> 1, 1
#> $ sequenceEnd                <int> 622, 465
#> $ sequenceChecksum           <chr> "9d6a071842e976c8de1949bd321bd38e", "3a1a81…
#> $ isUniProtReviewed          <lgl> TRUE, TRUE
#> $ gene                       <chr> "PCK1", "GCK"
#> $ uniprotAccession           <chr> "P35558", "P35557"
#> $ uniprotId                  <chr> "PCKGC_HUMAN", "HXK4_HUMAN"
#> $ uniprotDescription         <chr> "Phosphoenolpyruvate carboxykinase, cytosol…
#> $ taxId                      <int> 9606, 9606
#> $ organismScientificName     <chr> "Homo sapiens", "Homo sapiens"
#> $ isUniProtReferenceProteome <lgl> TRUE, TRUE
#> $ bcifUrl                    <chr> "https://alphafold.ebi.ac.uk/files/AF-P3555…
#> $ cifUrl                     <chr> "https://alphafold.ebi.ac.uk/files/AF-P3555…
#> $ pdbUrl                     <chr> "https://alphafold.ebi.ac.uk/files/AF-P3555…
#> $ paeImageUrl                <chr> "https://alphafold.ebi.ac.uk/files/AF-P3555…
#> $ msaUrl                     <chr> "https://alphafold.ebi.ac.uk/files/msa/AF-P…
#> $ plddtDocUrl                <chr> "https://alphafold.ebi.ac.uk/files/AF-P3555…
#> $ paeDocUrl                  <chr> "https://alphafold.ebi.ac.uk/files/AF-P3555…
#> $ entryId                    <chr> "AF-P35558-F1", "AF-P35557-F1"
#> $ uniprotSequence            <chr> "MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPD…
#> $ uniprotStart               <int> 1, 1
#> $ uniprotEnd                 <int> 622, 465
#> $ isReferenceProteome        <lgl> TRUE, TRUE
#> $ isReviewed                 <lgl> TRUE, TRUE

Note the message indicating that some UniProt identifiers (accessions) are not found in the AlphaFold database. The query returns a tibble containing columns with information on organism and UniProt characteristics (including protein sequence) , as well as URLs for files representing three-dimensional protein structure. We will use pdbUrl.

Protein structure

Focus on a particular UniProt identifier and the PDB url.

pdb_url <-
    prediction |>
    dplyr::filter(uniprotAccession == "P35557") |>
    dplyr::pull(pdbUrl)

Cache the PDB file using BiocFileCache, and read the PDB file using bio3d.

pdb_file <- BiocFileCache::bfcrpath(rnames = basename(pdb_url), fpath = pdb_url)
pdb <- bio3d::read.pdb(pdb_file)
pdb
#> 
#>  Call:  bio3d::read.pdb(file = pdb_file)
#> 
#>    Total Models#: 1
#>      Total Atoms#: 3642,  XYZs#: 10926  Chains#: 1  (values: A)
#> 
#>      Protein Atoms#: 3642  (residues/Calpha atoms#: 465)
#>      Nucleic acid Atoms#: 0  (residues/phosphate atoms#: 0)
#> 
#>      Non-protein/nucleic Atoms#: 0  (residues: 0)
#>      Non-protein/nucleic resid values: [ none ]
#> 
#>    Protein sequence:
#>       MLDDRARMEAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPT
#>       YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAE
#>       MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
#>       VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMI...<cut>...MLGQ
#> 
#> + attr: atom, xyz, seqres, calpha, call

Visualize the protein using r3dmol, using the ‘cartoon’ style.

r3dmol::r3dmol() |>
    ## use the PDB representation
    r3dmol::m_add_model(r3dmol::m_bio3d(pdb)) |>
    ## visualize as a 'cartoon' with alpha helices and beta sheets
    r3dmol::m_set_style(style = r3dmol::m_style_cartoon(arrow = TRUE)) |>
    ## fit molecule into display area
    r3dmol::m_zoom_to()

Average pathogenicity

Our goal is to visualize some measure of ‘average’ pathogenicity on the three-dimensional protein structure provided by AlphaFold. Start with a specific genome sequence (e.g., hg38). Filter to the amino acids in our UniProt region of interest.

P35557 <-
    am_data("hg38") |>
    dplyr::filter(uniprot_id == "P35557")

At each chromosome position, the AlphaMissense predictions contain several alternative alleles and hence protein variants. The (arithmetic) average pathogenicity (this is an extremely naive computation) at each amino acid position is

pathogenicity <- am_aa_pathogenicity(P35557)
pathogenicity
#> # A tibble: 464 × 9
#>    uniprot_id aa_pos aa_ref aa_pathogenicity_n aa_pathogenicity_mean
#>    <chr>       <int> <chr>               <int>                 <dbl>
#>  1 P35557          2 L                       5                0.0818
#>  2 P35557          3 D                       8                0.184 
#>  3 P35557          4 D                       8                0.147 
#>  4 P35557          5 R                       6                0.250 
#>  5 P35557          6 A                       6                0.138 
#>  6 P35557          7 R                       7                0.257 
#>  7 P35557          8 M                       9                0.142 
#>  8 P35557          9 E                       7                0.212 
#>  9 P35557         10 A                       6                0.142 
#> 10 P35557         11 A                       6                0.142 
#> # ℹ 454 more rows
#> # ℹ 4 more variables: aa_pathogenicity_median <dbl>,
#> #   aa_pathogenicity_min <dbl>, aa_pathogenicity_max <dbl>,
#> #   aa_pathogenicity_mode <fct>

Coloring amino acids by position

Individual amino acids can be colored using the colorfunc= argument to r3dmol::m_style_cartoon(). This is a Javascript function that takes each atom position and returns the corresponding color. The approach taken in AlphaMissenseR is to use a template, ultimately replacing ... with a vector of residue colors.

cat(
    AlphaMissenseR:::js_template("colorfunc", colors = "..."),
    "\n"
)
#> function(atom) {
#>     const residue_colors = [ ... ];
#>     return residue_colors[atom.resi];
#> }

The function af_colorfunc_by_position() provides a mechanism for translating a vector of scores between zero and one into a vector of colors. This is illustrated for a 12-amino acid sequence where the first and last residues are uncolored.

df <- tibble(
    pos = 1 + 1:10, # no color information for position 1
    value = 10:1 / 10
)
colorfunc <- af_colorfunc_by_position(
    df,
    "pos", "value",
    pos_max = 12    # no color information for position 12
)
cat(colorfunc, "\n")
#> function(atom) {
#>     const residue_colors = [ 'gray', '#8E063B', '#AB5468', '#C18692', '#D2B0B6', '#DDD0D2', '#D2D3DC', '#B3B7CF', '#8C94BF', '#5D6CAE', '#023FA5', 'gray' ];
#>     return residue_colors[atom.resi];
#> }

The following color function is similar to that used in af_prediction_view(), but uses the mean rather than median pathogenicity and scales the palette between the minimum and maximum values of the mean pathogenicity vector, rather than between 0 and 1.

colorfunc <-
    pathogenicity |>
    af_colorfunc_by_position(
        "aa_pos", "aa_pathogenicity_mean",
        length(pdb$seqres)
    )

Add this as the colorfunc= argument to m_style_cartoon() for visualization.

r3dmol::r3dmol() |>
    ## use the PDB representation
    r3dmol::m_add_model(r3dmol::m_bio3d(pdb)) |>
    ## visualize as a 'cartoon' with alpha helices and beta sheets
    r3dmol::m_set_style(
        style = r3dmol::m_style_cartoon(
            arrow = TRUE,
            ## color residue according to colorfunc
            colorfunc = colorfunc
        )
    ) |>
    ## fit molecule into display area
    r3dmol::m_zoom_to()

Visualizing genomic tracks

The variant effect prediction data can also be visualized in a genome browser view. This allows the user to explore the predicted pathogenicity of single nucleotide missense mutations in a gene of interest. This multi-scale visualization is based on Gosling, a grammar-based toolkit for scalable and interactive genomics data visualization.

For demonstration, we create a GPos object for a protein of interest.

gpos <-
    am_data("hg38") |>
    filter(uniprot_id == "Q1W6H9") |>
    to_GPos()

The function plot_granges invokes functionality from the shiny.gosling package to produce an interactive genome track plot in which the pathogenicity score for each point mutation in a linear genomic track.

The resulting plot is a Shiny app that can be displayed when running the following command in an interactive R session.

gosling_plot(
    gpos, plot_type = "bar",
    title = "Q1W6H9 track",
    subtitle = "bar plot example"
)
Bar plot for Q1W6H9
Bar plot for Q1W6H9

Alternatively, a multiscale-lollipop plot can be generated with the same function by changing the plot_type argument to highlight the predicted class outcomes for each mutation (ambigious, benign, pathogenic).

gosling_plot(
    gpos, plot_type = "lollipop",
    title = "Q1W6H9 track",
    subtitle = "lollipop plot example"
)
Lollipop plot for Q1W6H9
Lollipop plot for Q1W6H9

Finally

Remember to disconnect and shutdown all managed DuckDB connections.

db_disconnect_all()
#> * [07:37:08][info] disconnecting all registered connections

Database connections that are not closed correctly trigger warning messages.

Session information

sessionInfo()
#> R version 4.5.2 (2025-10-31)
#> Platform: x86_64-pc-linux-gnu
#> Running under: Ubuntu 24.04.4 LTS
#> 
#> Matrix products: default
#> BLAS:   /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 
#> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.26.so;  LAPACK version 3.12.0
#> 
#> locale:
#>  [1] LC_CTYPE=en_US.UTF-8       LC_NUMERIC=C              
#>  [3] LC_TIME=en_US.UTF-8        LC_COLLATE=C              
#>  [5] LC_MONETARY=en_US.UTF-8    LC_MESSAGES=en_US.UTF-8   
#>  [7] LC_PAPER=en_US.UTF-8       LC_NAME=C                 
#>  [9] LC_ADDRESS=C               LC_TELEPHONE=C            
#> [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C       
#> 
#> time zone: Etc/UTC
#> tzcode source: system (glibc)
#> 
#> attached base packages:
#> [1] stats     graphics  grDevices utils     datasets  methods   base     
#> 
#> other attached packages:
#> [1] AlphaMissenseR_1.7.1 dplyr_1.2.0          rmarkdown_2.30      
#> 
#> loaded via a namespace (and not attached):
#>  [1] gtable_0.3.6         xfun_0.56            bslib_0.10.0        
#>  [4] ggplot2_4.0.2        httr2_1.2.2          htmlwidgets_1.6.4   
#>  [7] vctrs_0.7.1          rjsoncons_1.3.2      tools_4.5.2         
#> [10] generics_0.1.4       stats4_4.5.2         curl_7.0.0          
#> [13] parallel_4.5.2       tibble_3.3.1         RSQLite_2.4.6       
#> [16] blob_1.3.0           shiny.gosling_1.7.0  pkgconfig_2.0.3     
#> [19] BiocBaseUtils_1.13.0 dbplyr_2.5.2         RColorBrewer_1.1-3  
#> [22] S4Vectors_0.49.0     S7_0.2.1             RcppSpdlog_0.0.27   
#> [25] lifecycle_1.0.5      compiler_4.5.2       farver_2.1.2        
#> [28] Seqinfo_1.1.0        GenomeInfoDb_1.47.2  httpuv_1.6.16       
#> [31] htmltools_0.5.9      sys_3.4.3            buildtools_1.0.0    
#> [34] sass_0.4.10          yaml_2.3.12          later_1.4.7         
#> [37] pillar_1.11.1        jquerylib_0.1.4      whisker_0.4.1       
#> [40] tidyr_1.3.2          cachem_1.1.0         mime_0.13           
#> [43] tidyselect_1.2.1     r3dmol_0.1.2         digest_0.6.39       
#> [46] duckdb_1.4.4         purrr_1.2.1          maketools_1.3.2     
#> [49] fastmap_1.2.0        grid_4.5.2           colorspace_2.1-2    
#> [52] cli_3.6.5            magrittr_2.0.4       spdl_0.0.5          
#> [55] utf8_1.2.6           withr_3.0.2          UCSC.utils_1.7.1    
#> [58] promises_1.5.0       filelock_1.0.3       scales_1.4.0        
#> [61] rappdirs_0.3.4       bit64_4.6.0-1        XVector_0.51.0      
#> [64] httr_1.4.8           bit_4.6.0            otel_0.2.0          
#> [67] memoise_2.0.1        shiny_1.13.0         evaluate_1.0.5      
#> [70] knitr_1.51           IRanges_2.45.0       GenomicRanges_1.63.1
#> [73] bio3d_2.4-5          BiocFileCache_3.1.0  rlang_1.1.7         
#> [76] Rcpp_1.1.1           xtable_1.8-8         glue_1.8.0          
#> [79] DBI_1.2.3            BiocGenerics_0.57.0  jsonlite_2.0.0      
#> [82] R6_2.6.1