mariadb-client-10.11.9-150600.4.6.1<>,pfp9|oOުI0Ͽox 8wB"ڂ3EH_ zؠhUj'b%bM]SJ H调ljF=Jy8x|j CaYg@>FT?T d & 9tx 17?!@! ! ! H!  i!  ! l! !  ! `  D(89L:w=C BCFCGC8!HC!ID@!XDdYD|ZD[D\D!]EX!^GAbGcH[dHeHfHlHuH!vIwQ!xQ!yRdzSSSSTCmariadb-client10.11.9150600.4.6.1Client for MariaDBThis package contains the standard clients for MariaDB.fh02-armsrv1SUSE Linux Enterprise 15SUSE LLC SUSE-GPL-2.0-with-FLOSS-exceptionhttps://www.suse.com/Productivity/Databases/Clientshttps://www.mariadb.orglinuxaarch64/usr/sbin/sysusers2shadow mysql-user.conf <<"EOF" || [ -f /.buildenv ] u mysql 60 "MySQL database admin" /var/lib/mysql EOF PPMRMX NmpMSMNH"   M))(*($1>}7`9ugAA큤ffNfOfOfPfPfPfOffffffff fffPfffffffftftftftftftftff2618c4242f48e7a984cc0c95bbac507a4732f043e21f140a95cc87c26a093a953785b7c49c0f26c45e8cc12531c3315fbbb3bd06f122a7fb5ee42c4f11a5ba2a264888fdc994f5e46a20f315561fbde6304a6a6830a4447cd6cb199eefd5f9daa56cede51d85b0fe98ffc0ced57bc8baecf5c106e8ff1d58eea9060727a34b7982d6a09463db65c2975347e43f8bce81118bb63a2ecd7d16d1fce4840f275953832ccd84c1ce3fb4fc1add0229d991fd38b44f4a48f5f629a64df28d0e708cc19d1bb02d770f44ba1577810e8c842568f556ed5165e334ecd74a642244769a7ca2196b2c7aa15e6efcee94aa0d978344ea0e846dd2d5a9d7ba4451f3a99e183ca8ece4659a9e724f8ff4fa607797b31d9dd45af1aa1a508127c9d8b465ceba9cf5cae6b01b765c3e6a33580e86ef679ddd49be96dbe883aafb73b05eed3b22e1be4318acaa2e00a39edf548e9d5ae129fa7f0dfb66ad1e63b824a6df9f03f44c2ccaa9faf36cf2867e67e2cdf1a1d8ebab0d285930b55da375ae964894a7eea7987e92c69f5547d59d33de9b4724121ceb65f3ff50c5bce5ae6b01fd0a80239c692557c1f2bd8f2e981cae9a934da46e5ac1cf8c57c728c51a53b107f334e71e18157e03db02c9b73c81ac192d173ff85a6847f601493f66f087b76855fe9032d683106781bedcbdca6c0398206fd74191991b8feb11568100b4eee81665e5e8dd90090149be367d766a5b7c37c56b305a14a4ac0429741138a026a3340b61263658e9b2231f75935c9171b3c75a6c27f42d6805137ec6b569202dbdcbee7e79396479f07a9bc83beac587fb65d112a51f04d2696f5809fe76ba8ff0b1446c463d4e95dfbd7d0ab4ed7439ce24a94289dd26a9e923e7d37ba994c3159e53dd306af69ebad50269e536088db23b2e9f33f3f9e201970664babe05be35a53255a5307037f6de37d3126304efc9766ca12aca87f4bcff9c45a17695b596c61cb51ca67bc6b7ccd8baddc0f2e2a95b3c849adbe84cfd27079bc7a6cefd2fe4b51bb214f89960ea87f3f3dd2a052f3c999aef1547c2757474c7b210c22adab597dfmariadbmariadb-adminmariadb-checkmariadbd-safe-helpermariadb-dumpmariadb-importmariadb-showrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmariadb-10.11.9-150600.4.6.1.src.rpmconfig(mariadb-client)group(mysql)mariadb-clientmariadb-client(aarch-64)mysql-clientuser(mysql)@@@@@@@@@@@@@ @@@@@@@@@     /bin/shconfig(mariadb-client)ld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.33)(64bit)libc.so.6(GLIBC_2.34)(64bit)libc.so.6(GLIBC_2.38)(64bit)libcrypto.so.3()(64bit)libcrypto.so.3(OPENSSL_3.0.0)(64bit)libedit.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libmariadb3libncurses.so.6()(64bit)libncurses.so.6(NCURSEST6_5.7.20081102)(64bit)libssl.so.3()(64bit)libssl.so.3(OPENSSL_3.0.0)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libz.so.1()(64bit)mariadb-errormessagesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysuser-shadow10.11.9-150600.4.6.13.010.11.93.0.4-14.6.0-14.0-15.2-13.2mysql-client4.14.3ffU@ee]@e@dd}@dldxc>@c`cj@cwsck@c*c pcM@bb(bw@b'E@b @a͟@a@a@aKaKaW@aba@a~@a^@a]aHwa6a@aG```KW`*b@`@`@_ǁ_#__N7_N7_3_'@^y^א^^Ǿ^@^@^v^y@^V]^U @^U @^O@^=Q@^:@^9\^9\^6^*@^,]@]@]M@]@]p]L]J@]D%]D%]9]8H@]\]@\ڭ\N\@\v{\n\j@\f\eX@\b@\-@\@\w[@[G[t[Q@[9@[[ @[M@[WZ@Z@Z@ZZ@ZH@Z$ZZaZOhZKt@Z;@ZZ@Z@YeYeY@YYcl@Y-^X@X,XpXXbWXAb@X W]NW+5V@V\:@UM@U@U@U>U@UJ@U-@U-@U@U.@T@TPT7T@TT_W@antonio.teixeira@suse.comantonio.teixeira@suse.comdanilo.spinella@suse.comoss@danyspin97.orgdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comchris@computersalat.dedanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comgmbr3@opensuse.orgdanilo.spinella@suse.comdanilo.spinella@suse.comsuse-beta@cboltz.dedanilo.spinella@suse.comjsegitz@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comrpm@fthiessen.dedimstar@opensuse.orgkstreitova@suse.comkstreitova@suse.commrueckert@suse.demrueckert@suse.demrueckert@suse.dekstreitova@suse.commarec@detebe.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgkstreitova@suse.comdimstar@opensuse.orgguillaume.gardet@opensuse.orgpgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comidonmez@suse.commliska@suse.czkukuk@suse.comschwab@suse.depgajdos@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comstefan.bruens@rwth-aachen.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.commliska@suse.czkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comsuse+build@de-korte.orgrick.salevsky@suse.comtbechtold@suse.comnicolas.bock@suse.comkstreitova@suse.comkstreitova@suse.comadrian.glaubitz@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkukuk@suse.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comro@suse.dersalevsky@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.orgkstreitova@suse.comrhafer@suse.devcizek@suse.comkstreitova@suse.comvcizek@suse.combwiedemann@suse.comvcizek@suse.comkstreitova@suse.comfvogt@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.org13ilya@gmail.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichal.hrusecky@opensuse.orgmichal.hrusecky@opensuse.orgdvaleev@suse.comsweet_f_a@gmx.demichal.hrusecky@opensuse.orgmgorse@suse.comxrigou@otenet.grxrigou@otenet.grmichal.hrusecky@opensuse.orgledest@gmail.com- Update to 10.11.9: https://mariadb.com/kb/en/mariadb-10-11-9-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-9-changelog/ * fixes for the following security vulnerabilities: 10.11.9: none - Update list of skipped tests- Update to 10.11.8: https://mariadb.com/kb/en/mariadb-10-11-8-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-8-changelog/ * fixes for the following security vulnerabilities: 10.11.8: CVE-2024-21096 (bsc#1225983) 10.11.7: none - Refreshed patches: * mariadb-10.2.4-fortify-and-O.patch * mariadb-10.2.4-logrotate.patch * mariadb-10.4.12-fix-install-db.patch * mariadb-10.4.12-harden_setuid.patch - Update list of skipped tests- Update list of skipped tests for ppc64le- Update to 10.11.6: https://mariadb.com/kb/en/mariadb-10-11-6-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-6-changelog/ * fixes for the following security vulnerabilities: 10.11:6: CVE-2023-22084, (bsc#1217405) - Refreshed patches: * mariadb-10.4.12-fix-install-db.patch- update the list of the skipped tests for s390x, fix bsc#1215255- Update to 10.11.5: https://mariadb.com/kb/en/mariadb-10-11-5-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-5-changelog/ https://mariadb.com/kb/en/mariadb-10-11-4-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-4-changelog/ * fixes for the following security vulnerabilities: 10.11.5: none 10.11.4: none - Issues that aren't affecting this package: * CVE-2021-46669 * CVE-2022-27376 (bsc#1198628) * CVE-2022-27377 (bsc#1198603) * CVE-2022-27378 (bsc#1198604) * CVE-2022-27379 (bsc#1198605) * CVE-2022-27380 (bsc#1198606) * CVE-2022-27381 (bsc#1198607) * CVE-2022-27382 (bsc#1198609) * CVE-2022-27383 (bsc#1198610) * CVE-2022-27384 (bsc#1198611) * CVE-2022-27386 (bsc#1198612) * CVE-2022-27387 (bsc#1198613) * CVE-2022-27444 (bsc#1198634) * CVE-2022-27445 (bsc#1198629) * CVE-2022-27446 (bsc#1198630) * CVE-2022-27447 (bsc#1198631) * CVE-2022-27448 (bsc#1198632) * CVE-2022-27449 (bsc#1198633) * CVE-2022-27451 (bsc#1198639) * CVE-2022-27452 (bsc#1198640) * CVE-2022-27455 (bsc#1198638) * CVE-2022-27456 (bsc#1198635) * CVE-2022-27457 (bsc#1198636) * CVE-2022-27458 (bsc#1198637) * CVE-2022-32088 (bsc#1201168) * CVE-2022-32087 (bsc#1201167) * CVE-2022-32086 (bsc#1201166) * CVE-2022-32085 (bsc#1201165) * CVE-2022-32083 (bsc#1201163) * CVE-2022-21427 * bsc#1199928 * bsc#1195076 * jsc#SLE-22245- Skip test on s390x to fix build on ALP, bsc#1211859 - Update list of skipped tests- Refresh gcc13-fix.patch - Update to 10.11.3: * release notes and changelog: https://mariadb.com/kb/en/mariadb-10-11-3-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-3-changelog/ * fixes for the following security vulnerabilities: 10.11.3: CVE-2022-47015 (bsc#1207404)- Cherry-pick upstream changes (gcc13-fix.patch) for GCC 13.- Update to 10.11.2: * release notes and changelog: https://mariadb.com/kb/en/changes-improvements-in-mariadb-1011/ https://mariadb.com/kb/en/mariadb-10-11-2-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-2-changelog/ https://mariadb.com/kb/en/mariadb-10-11-1-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-1-changelog/ https://mariadb.com/kb/en/mariadb-10-11-0-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-0-changelog/ - Refresh mariadb-10.2.4-logrotate.patch- Update to 10.10.3: https://mariadb.com/kb/en/mariadb-10-10-3-release-notes/ https://mariadb.com/kb/en/mariadb-10-10-3-changelog/ - Update mariadb.keyring- Update list of skipped tests- Update to 10.10.2: * release notes and changelog: https://mariadb.com/kb/en/changes-improvements-in-mariadb-1010/ https://mariadb.com/kb/en/mariadb-10-10-2-release-notes/ https://mariadb.com/kb/en/mariadb-10-10-2-changelog/ https://mariadb.com/kb/en/mariadb-10101-release-notes/ https://mariadb.com/kb/en/mariadb-10101-changelog/ https://mariadb.com/kb/en/mariadb-10100-release-notes/ * fixes for the following security vulnerabilities: 10.10.2: none- Update to 10.9.4: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1094-release-notes https://mariadb.com/kb/en/library/mariadb-1094-changelog * fixes for the following security vulnerabilities: 10.9.4: none- Update to 10.9.3: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1093-release-notes https://mariadb.com/kb/en/library/mariadb-1093-changelog- Update to 10.9.2: * changes and improvements in MariaDB 10.9: https://mariadb.com/kb/en/changes-improvements-in-mariadb-109/ * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1092-release-notes https://mariadb.com/kb/en/library/mariadb-1092-changelog https://mariadb.com/kb/en/library/mariadb-1091-release-notes https://mariadb.com/kb/en/library/mariadb-1091-changelog https://mariadb.com/kb/en/library/mariadb-1090-release-notes https://mariadb.com/kb/en/library/mariadb-1090-changelog * fixes for the following security vulnerabilities: 10.9.2: CVE-2022-32082 (bsc#1201162) CVE-2022-32089 (bsc#1201169) CVE-2022-32081 (bsc#1201161) CVE-2022-32091 (bsc#1201170) CVE-2022-32084 (bsc#1201164) CVE-2022-38791 (bsc#1202863) * The package is not affected by the following security vulnerabilities: CVE-2018-25032 (bsc#1197459) - Update list of skipped tests- Update mysql-systemd-helper to be aware of custom group, bsc#1200105 - Respect socket setting in mysql-systemd-helper - Fix my_print_defaults call in mysql-system-helper- use the better collation as default * DDEFAULT_COLLATION=utf8mb4_unicode_520_ci- Update list of skipped tests * suse_skipped_tests.list- Update to 10.8.3: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1083-release-notes https://mariadb.com/kb/en/library/mariadb-1083-changelog https://mariadb.com/kb/en/library/mariadb-1082-release-notes https://mariadb.com/kb/en/library/mariadb-1082-changelog https://mariadb.com/kb/en/library/mariadb-1081-release-notes https://mariadb.com/kb/en/library/mariadb-1081-changelog https://mariadb.com/kb/en/library/mariadb-1080-release-notes https://mariadb.com/kb/en/library/mariadb-1080-changelog - Remove upstreamed patch: * bsc1194828.patch- Do not include mariadb-galera files in the main package when %{with galera} is false- Update to 10.7.3 (bsc#1196016): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1073-release-notes https://mariadb.com/kb/en/library/mariadb-1073-changelog https://mariadb.com/kb/en/library/mariadb-1072-release-notes https://mariadb.com/kb/en/library/mariadb-1072-changelog https://mariadb.com/kb/en/library/mariadb-1071-release-notes https://mariadb.com/kb/en/library/mariadb-1071-changelog https://mariadb.com/kb/en/library/mariadb-1070-release-notes https://mariadb.com/kb/en/library/mariadb-1070-changelog * fixes for the following security vulnerabilities: 10.7.3: CVE-2021-46665 CVE-2021-46664 CVE-2021-46661 CVE-2021-46668 CVE-2021-46663 10.7.2: CVE-2022-24052 CVE-2022-24051 CVE-2022-24050 CVE-2022-24048 CVE-2021-46659, bsc#1195339 10.7.1: none 10.7.0: none - Remove upstreamed patches: * mariadb-10.0.15-logrotate-su.patch * mariadb-10.1.1-mysqld_multi-features.patch - Refresh mariadb-10.2.4-logrotate.patch - Update list of skipped tests - Add bsc1194828.patch to fix build with GCC12, fixes bsc#1194828 - The following issues have already been fixed in this package but weren't previously mentioned in the changes file: CVE-2021-46658, bsc#1195334 CVE-2021-46657, bsc#1195325- Build mariadb-galera on SLE - Add dependency on galera-4 for mariadb-galera - Remove old constraints for mariadb-galera- The following issues have already been fixed in this package but weren't previously mentioned in the changes file: bsc#1189320 CVE-2021-2154, bsc#1185872 CVE-2021-2166, bsc#1185870 CVE-2021-27928, bsc#1183770 MDEV-23851- Fix rpmlint errors - Run spec-cleaner- Enable LZ4 compression for INNODB and ROCKSDB, fixes bsc#1186031- Revert systemd hardening * Remove harden_mariadb.service.patch- Add CONFIG parameter to %sysusers_generate_pre- Update to 10.6.5 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1065-release-notes https://mariadb.com/kb/en/library/mariadb-1065-changelog * fixes for the following security vulnerabilities: 10.6.5: none - Not affected by [CVE-2021-35604], bsc#1192497 - Drop upstreamed patch: * mariadb-10.2.19-link-and-enable-c++11-atomics.patch- Use pam macros instead of hardcoding directories, fixes bsc#1191038 - Add fix-pamdir.patch- Add func_math_tests_MDEV-26645.diff to avoid test failures in the func_math test on Tumbleweed s390x and ppc64 until MDEV-26645 gets fixed upstream- Fix socket address in mariadb@.socket file- Added hardening to systemd service(s) (bsc#1181400). Added patch(es): * harden_mariadb.service.patch Modified: * mariadb.service.in- Replace %{_rpmconfigdir}/macros.d with %{_rpmmacrodir}, remove ownership of this directory. Fixes boo#1182218 - Run spec-cleaner- Update to 10.6.4 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1064-release-notes https://mariadb.com/kb/en/library/mariadb-1064-changelog https://mariadb.com/kb/en/library/mariadb-1063-release-notes https://mariadb.com/kb/en/library/mariadb-1063-changelog https://mariadb.com/kb/en/library/mariadb-1062-release-notes https://mariadb.com/kb/en/library/mariadb-1062-changelog https://mariadb.com/kb/en/library/mariadb-1061-release-notes https://mariadb.com/kb/en/library/mariadb-1061-changelog https://mariadb.com/kb/en/library/mariadb-1060-release-notes https://mariadb.com/kb/en/library/mariadb-1060-changelog * fixes for the following security vulnerabilities: 10.6.4: CVE-2021-2372 CVE-2021-2389 - Removed support to tokudb as it has been removed from upstream - Refresh mariadb-10.2.4-fortify-and-O.patch - Add new systemd socket from upstream- Support both rpmlint 1.x and 2.x.- Update rpmlint rules in order to work with rpmlint2 (bsc#1179049).- Update to version 10.5.10 * Fix CVE-2021-2154 * Add ST_DISTANCE_SPHERE for calculating the spherical distance between two geometries (point or multipoint) on a sphere * Fix: Crash with invalid multi-table update of view in 2nd execution of SP * Fix: Incorrect name resolution for subqueries in ON expressions * Fix: Complex query in Store procedure corrupts results * Fix: DELETE HISTORY may delete current data on system-versioned table * Fix: Crashes with nested table value constructors * Fix: Server crashes in thd_clear_errors() * Fix: The statement set password=password('') executed in PS mode fails in case it is run by a user with expired password * Full changes: https://mariadb.com/kb/en/mariadb-10510-changelog/ - Drop mariadb-10.5.9-cmake-3.20.patch, applied upstream- Add mariadb-10.5.9-cmake-3.20.patch: Fix syntax error which is exposed by cmake 3.20.- Update to 10.5.9 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1059-release-notes https://mariadb.com/kb/en/library/mariadb-1059-changelog * fixes for the following security vulnerabilities: 10.5.9: none - Tracker bug: [bsc#1182739] - Update fixes [bsc#1182255] (MDL BF-BF Conflict caused by TRUNCATE TABLE) - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - remove fix-lock-rollback-assert-abort.patch (applied upstream)- update the list of the skipped tests- exclude galera files if we build without this feature. - switch from 664 to 644 for my.cnf configuration file (probably a typo)- added fix-lock-rollback-assert-abort.patch fix an abort when a transaction is rolled back - track all patches in a series so we can easily set up a quilt tree without requiring all the devel packages- switch to bcond_with to make it easier to enable galera support via the prjconfig - fix non galera case for building- Update to 10.5.8 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1058-release-notes https://mariadb.com/kb/en/library/mariadb-1058-changelog * fixes for the following security vulnerabilities: 10.5.7: CVE-2020-14812, CVE-2020-14765, CVE-2020-14776, CVE-2020-14789 10.5.8: none - tracker bugs: [bsc#1177472] and [bsc#1178428] - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - update suse_skipped_tests.list- update to 10.5.6 * release notes and changelog https://mariadb.com/kb/en/mariadb-1056-release-notes https://mariadb.com/kb/en/mariadb-1056-changelog * fixes for the following security vulnerabilities: 10.5.6: CVE-2020-15180 < 10.5.6: none - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - drop mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch - mariadb now builds against pcre2 - added binaries aria_s3_copy and mariadb-conv to tools subpackage - added type_test.type_test_double to list of skipped tests- Using basic.target dependencies is not needed with any systemd release unless DefaultDependencies is disabled, remove from unit files- Mariadb uses hrtimers with absolute CLOCK_REALTIME values, this won't work correctly if the clock isn't set and will do funny things if it goes backward after starting the server as POSIX says that the new clock value shall influence them, start the service after time-sync.target to workaround the problem.- Update to 10.4.14 [bsc#1175596] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10414-release-notes https://mariadb.com/kb/en/library/mariadb-10414-changelog * fixes for the following security vulnerabilities: none * the update fixes [bsc#1174559] and [bsc#1173516] (MariaDB crashes at db_sync from Keystone) - refresh mariadb-10.2.4-fortify-and-O.patch - fix patch sequence - run spec-cleaner - build galera for openSUSE only - update suse_skipped_tests.list - tune the testsuite to avoid randomly failing tests- Fix installed .service files to follow the /usr/lib -> /usr/libexec move (boo#1174811).- Update _constraints to make it more readable and request more memory for aarch64 to avoid occasionnal OOM errors on %check- rpm macros: $TEST_USER identified by $TEST_PASS is actually user of the database for which client conf should be made for - rpm macros: database name or names can be specified as a %mysql_testserver_start and %mysql_testserver_cconf parameter - modified sources % macros.mariadb-test- Build with oqgraph by default for all codestreams [jsc#SLE-12253]- Update to 10.4.13 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10413-release-notes https://mariadb.com/kb/en/library/mariadb-10413-changelog * fixes for the following security vulnerabilities: CVE-2020-2752, CVE-2020-2812, CVE-2020-2814, CVE-2020-2760, CVE-2020-13249 - fixes [bsc#1168380] (the same as [bsc#1166781]) MDEV-21244 mysql_upgrade creating empty global_priv table support upgrades from 5.2 privilege tables - drop specfile "hacks" as things work correctly in upstream now: * renaming tmpfiles.conf -> mariadb.conf * installing pam_user_map.so to /lib64/security for non 32bit architectures * sysusers.conf was renamed to mariadb.conf - update suse_skipped_tests.list- move mariadb-client-test from client subpackage to test subpackage so the symlink from mariadb-client-test -> mysql_client_test works [bsc#1170204]- Add oqgraph.social to the suse_skipped_tests.list (reported upstream as MDEV-22280) [bsc#1169369]- Add -Wl,-Bsymbolic -Wl,-Bsymbolic-functions to linker flags so that symbols are resolved locally if possible, this will avoid https://bugs.kde.org/show_bug.cgi?id=391362- Add mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch in order to fix boo#1158405 (MDEV-21248).- Cleanup mysql user creation/handling and use sysusers.d- Bump disk constraint to 18Gb- test macros: clarify who is admin and user of the database, fix build with 10.4 - modified sources % macros.mariadb-test- remove @VERSION@ from mariadb.service and mariadb@.service- disable testing with rpm macros as it does not work as for 10.4, needs to be investigated- update suse_skipped_tests.list for ppc- rename mariadb.rpmlintrc to mariadb-rpmlintrc - for ppc install pam_user_map.so in /lib/security- rename mariadb-10.2.12-harden_setuid.patch to mariadb-10.4.12-harden_setuid.patch to match the correct version number. - add mariadb-10.4.12-fix-install-db.patch to improve default behaviour of mysql_install_db. This prevents performing security sensitive actions to be performed but instead only warns the caller (bsc#1160868).- update to 10.4.12 [jsc#SLE-8269] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10412-release-notes https://mariadb.com/kb/en/library/mariadb-10412-changelog https://mariadb.com/kb/en/library/mariadb-10411-release-notes https://mariadb.com/kb/en/library/mariadb-10411-changelog * fixes for the following security vulnerabilities: CVE-2020-2574 * don't let mysql_install_db set SUID bit for auth_pam_tool in rpm/deb packages CVE-2020-7221 [bsc#1160868] - add mariadb-10.2.12-harden_setuid.patch to harden auth_pam_tool setuid-root binary [bsc#1160285] - pack pam_user_map.so module in the /%{_lib}/security directory and user_map.conf configuration file in the /etc/security directory - fix race condition with mysql_upgrade_info status file by moving it to the location owned by root (/var/lib/misc) CVE-2019-18901 [bsc#1160895] - move .run-mysql_upgrade file from $datadir/.run-mysql_upgrade to /var/lib/misc/.mariadb_run_upgrade so the mysql user can't use it for a symlink attack [bsc#1160912] - change -DWITH_COMMENT and -DCOMPILATION_COMMENT to be SUSE/openSUSE independent- enhance mariadb.service and mariadb@.service with various options (Documentation=, User=, Group=, KillSignal=, SendSIGKILL=, Restart=, RestartSec=, CapabilityBoundingSet=, ProtectSystem=, ProtectHome=, PermissionsStartOnly= and UMask=) [bsc#1160878] - mysql-systemd-helper: use systemd-tmpfiles instead of shell script operations for a cleaner and safer creating of /run/mysql [bsc#1160883]- update to 10.4.10 * changes and improvements for 10.4 https://mariadb.com/kb/en/changes-improvements-in-mariadb-104/ * fixes for the following security vulnerabilities: none - pack mariadb variants of the mysql binaries (e.g. mariadb-dumpslow is a symlink to mysqldumpslow and the like) - refresh mariadb-10.2.4-fortify-and-O.patch - update suse_skipped_tests.list - _constraints: increase physicalmemory value - package auth_pam_tool setuid binary properly - add cracklib-password-check subpackage but do not build it right now (cracklib-dict-full >= 2.9.0 is not available yet) - add rcmariadb compat link - add mariadb.rpmlintrc file - do not move my_safe_process to bindir but use rpmlint arch-dependent-file-in-usr-share exception for it (this file is used just for the testing and it doesn't have to be in bindir- added rpm test macros: %mysql_testserver_start, %mysql_testserver_cconf, %mysql_testserver_stop First two consuments are python-sortinghat and python-mysqlclient.- update the list of the skipped tests- update to 10.3.20 * notable changes for 10.3.20 * MDEV-20987: InnoDB fails to start when FTS table has FK relation * notable changes for 10.3.19 * MDEV-20864: Debug-only option innodb_change_buffer_dump for dumping the contents of the InnoDB change buffer to the server error log at startup. * MariaBackup: * MDEV-18438: mbstream recreates xtrabackup_info on same directory as backup file * MDEV-20703: mariabackup creates binlog files in serve binlog directory on --prepare --export step * FULLTEXT INDEX: * MDEV-19647: Server hangs after dropping full text indexes and restart * MDEV-19529: InnoDB hang on DROP FULLTEXT INDEX * MDEV-19073: FTS row mismatch after crash recovery * MDEV-20621: FULLTEXT INDEX activity causes InnoDB hang * MDEV-20927: Duplicate key with auto increment * ALTER TABLE: * MDEV-20799: DROP Virtual Column crash * MDEV-20852: BtrBulk is unnecessarily holding dict_index_t::lock * System-Versioned Tables: * MDEV-16210: FK constraints on versioned tables use historical rows, which may cause constraint violation * MDEV-20812: Unexpected ER_ROW_IS_REFERENCED_2 or server crash in row_ins_foreign_report_err upon DELETE from versioned table with FK * Galera wsrep library updated to 25.3.28 * Fixes for the following security vulnerabilities: CVE-2019-2974, CVE-2019-2938 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10320-release-notes https://mariadb.com/kb/en/library/mariadb-10320-changelog https://mariadb.com/kb/en/library/mariadb-10319-release-notes https://mariadb.com/kb/en/library/mariadb-10319-changelog - remove mariadb-10.3.17-fix_ppc_build.patch (applied upstream) - refresh * mariadb-10.2.4-logrotate.patch * mariadb-10.0.15-logrotate-su.patch- update to 10.3.18 * notable changes * Connect updated to Connect 1.06.0010 * MDEV-20066: This bug could cause a table to become corrupt if a column was added instantly * MDEV-15326: A race condition in InnoDB transaction commit that affects record locking was fixed * MDEV-17187: Table doesn't exist in engine after ALTER of FOREIGN KEY * MDEV-20301: InnoDB's MVCC has O(N^2) behaviors * MDEV-18128: Simplify .ibd file creation * MDEV-20060: Failing assertion: srv_log_file_size <= 512ULL << 30 while preparing backup * MDEV-20247: Replication hangs with "preparing" and never starts * MDEV-17614: Remove unnecessary locking for INSERT...ON DUPLICATE KEY UPDATE * MDEV-20311: row_ins_step accesses uninitialized memory * MDEV-19947: Repositories for RHEL 8 ppc64le added * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10318-release-notes https://mariadb.com/kb/en/library/mariadb-10318-changelog- Use instead of for _constraints, increasing the worker pool on x86_64 from 6 to >700.- remove sql_mode from my.ini/my.cnf as NO_ENGINE_SUBSTITUTION and STRICT_TRANS_TABLES are already set by default from version 10.2.4 [bsc#1144314]- add mariadb-10.3.17-fix_ppc_build.patch to fix a compilation failure for ppc if ${CRC32_LIBRARY} target has no COMPILE_FLAGS yet. Then GET_TARGET_PROPERTY returns COMPILE_FLAGS-NOTFOUND, which doesn't work very well when it's later fed back into COMPILE_FLAGS. - _constraints: increase the memory because of the ppc build - adjust mysql-systemd-helper ("shutdown protected MySQL" section) so it checks both ping response and the pid in a process list as it can take some time till the process is terminated. Otherwise it can lead to "found left-over process" situation when regular mariadb is started [bsc#1143215]- update to 10.3.17 [bsc#1141798] * notable changes: * MDEV-19795: Merge upstream MyRocks. * MDEV-17228: Encrypted temporary tables are not encrypted. * MDEV-18328: Disks Plugin is now stable and requires the FILE privilege. * Merge relevant InnoDB changes from MySQL 5.7.27 * Adjust spin loops to the x86 PAUSE instruction latency * CREATE TABLE: MDEV-19292, MDEV-20102 * ALTER TABLE: MDEV-15641, MDEV-19630, MDEV-19916, MDEV-19974 * Indexed virtual columns: MDEV-16222, MDEV-17005, MDEV-19870 * FULLTEXT INDEX: MDEV-14154 * Encryption: MDEV-17228, MDEV-19914 * Galera + FOREIGN KEY: MDEV-19660 * Recovery & Mariabackup: MDEV-19978 * MDEV-19781: Add page id matching check in innochecksum tool * MDEV-20091: DROP TEMPORARY table is logged despite no CREATE was logged * MDEV-19427: mysql_upgrade_service throws exception upgrading from 10.0 to 10.3 * MDEV-19814: Server crash in row_upd_del_mark_clust_rec or Assertion * MDEV-17363: Compressed columns cannot be restored from dump * fixes for the following security vulnerabilities: CVE-2019-2805, CVE-2019-2740, CVE-2019-2739, CVE-2019-2737, CVE-2019-2758 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10317-release-notes https://mariadb.com/kb/en/library/mariadb-10317-changelog - add "BuildRequires: python3" as some tests and myrocks_hotbackup script need python3. Make the PYTHON_SHEBANG value configurable [bsc#1142909] - remove "innodb_file_format" option from my.ini (my.cnf) file that was removed in MariaDB 10.3.1. Also remove "innodb_file_per_table=ON" option that is by default ON and it's redundant now. - remove mariadb-10.2.9-galera_cnf.patch as it's not clear what the correct path to galera wsrep provider is while users can use galera 3, galera 4 or galera compiled on their own - add "Requires: python3-mysqlclient" that is needed by myrocks_hotbackup script- Use FAT LTO objects in order to provide proper static library.- remove client_ed25519.so plugin because it's shipped in mariadb-connector-c package (libmariadb_plugins)- removal of SuSEfirewall2 service, since SuSEfirewall2 has been replaced by firewalld, see [1]. [1]: https://lists.opensuse.org/opensuse-factory/2019-01/msg00490.html- update to 10.3.16 [bsc#1108088] * notable changes: * MDEV-19490: show tables fails when selecting the information_schema database * MDEV-19491: multi-update with triggers and stored routines * MDEV-19541: InnoDB crashes when trying to recover a corrupted page * MDEV-19725: Incorrect error handling in ALTER TABLE * MDEV-19445: FULLTEXT INDEX fix * MDEV-19486: System Versioning fix * MDEV-19509: InnoDB skips the tablespace in rotation list * MDEV-19614: SET GLOBAL innodb_ deadlock due to LOCK_global_system_variables * MDEV-17458: Unable to start galera node * MDEV-17456: Malicious SUPER user can possibly change audit log configuration without leaving traces * MDEV-19588: Wrong results from query, using left join * MDEV-19258: RIGHT JOIN hangs in MariaDB * Virtual columns fixes: MDEV-19027, MDEV-19602 * Crash recovery fixes: MDEV-13080, MDEV-19587, MDEV-19435 * MDEV-11094: Fixed row-based event applying with an error anymore when the events aim at the blackhole engine and row annotation is enabled * MDEV-19076: Fixed slave_parallel_mode=optimistic did not always properly order replication events on temporary tables in some case to attempt execution before a parent event has been already processed * MDEV-19158: Fixed duplicated entries in binlog occurred in combination of LOCK TABLES and binlog_format=MIXED when a being locked table was under replication unsafe operation * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10316-release-notes https://mariadb.com/kb/en/library/mariadb-10316-changelog - fix reading options for multiple instances if my${INSTANCE}.cnf is used. Also remove "umask 077" from mysql-systemd-helper that causes that new datadirs are created with wrong permissions. Set correct permissions for files created by us (mysql_upgrade_info, .run-mysql_upgrade) [bsc#1132666] - remove mariadb-5.5.28-install_db-quiet.patch and add "--rpm" option to the mysql_install_db script that does basically the same [bsc#1080891] - remove mariadb-10.1.12-deharcode-libdir.patch because it's not needed - we don't build libmariadb library in mariadb package anymore so we don't need to take care about LIBDIR and PLUGINDIR here. Moreover we shouldn't (and we don't) touch *_RPM variables as they are internal) [bsc#1080891] - update suse_skipped_tests.list- update to 10.3.15 * see changes in 10.3 series https://mariadb.com/kb/en/library/changes-improvements-in-mariadb-103/ * fixes for the following security vulnerabilities: [CVE-2019-2503] (the rest was already applied for 10.2) - remove mysql-community-server-5.1.45-multi-configuration.patch as we have the same configuration in /etc/my.cnf and it doesn't make any sense to keep it twice. Moreover the patched file support-files/my-medium.cnf.sh was removed in upstream - remove mariadb-5.2.3-cnf.patch as all patched files were removed upstream - refresh mariadb-10.2.4-fortify-and-O.patch - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch and use a simplified version from Debian - refresh README.install and suse-test-run - remove caching_sha2_password.so as it's shipped in mariadb-connector-c package (libmariadb_plugins) - rename libmysqld subpackage (embedded library) to libmariadbd as libmysqld.so was renamed to libmariadbd.so (MDEV-14953) - simplify removing static libs (we don't need to have .static) - add perl(Memoize) and perl(Symbol) to BuildRequires and Requires that are needed for tests - replace Requires pwdutils with shadow - build RocksDB only for x86_64 as other platforms are not supported - remove xtrabackup scripts as we already removed xtrabackup requires and it doesn't work for MariaDB 10.3 anyway - run spec-cleaner - tracker bugs for version updates in between: * 10.2.25 tracker bug [bsc#1136035] * 10.2.29 tracker bug [bsc#1156669]- update to 10.2.24 GA [bsc#1122198] * notable changes: * MDEV-18968 - Both (WHERE 0.1) and (WHERE NOT 0.1) return empty set * MDEV-18466 - Unsafe to log updates on tables referenced by foreign keys with triggers in statement format * MDEV-18899 - Server crashes in Field::set_warning_truncated_wrong_value * MDEV-18298 - Crashes server with segfault during role grants * MDEV-17610 - Unexpected connection abort after certain operations from within stored procedure * MDEV-19112 - WITH clause does not work with information_schema as default database * MDEV-17830 - Server crashes in Item_null_result::field_type upon SELECT with CHARSET(date) and ROLLUP * MDEV-14041 - Server crashes in String::length on queries with functions and ROLLUP * MDEV-18920 - Prepared statements with st_convexhull hang and eat 100% cpu. * MDEV-15837 - Assertion item1->type() == Item::FIELD_ITEM && item2->type() == Item::FIELD_ITEM * MDEV-9531 - GROUP_CONCAT with ORDER BY inside takes a lot of memory while it's executed * MDEV-17036 - BULK with replace doesn't take the first parameter in account * Bug#28986737 - RENAMING AND REPLACING MYSQL.USER TABLE CAN LEAD TO A SERVER CRASH * MDEV-19350 - Server crashes in delete_tree_element / ... / Item_func_group_concat::repack_tree * MDEV-19188 - Server Crash When Using a Trigger With A Number of Virtual Columns on INSERT/UPDATE * MDEV-19352 - Server crash in alloc_histograms_for_table_share upon query from information schema InnoDB * InnoDB persistent corruption fixes: MDEV-19426, MDEV-19022, MDEV-19241, MDEV-13942 * InnoDB recovery fixes and speedup: MDEV-18733, MDEV-12699, MDEV-19356, MDEV-19426 * MDEV-14398 - innodb_encrypt_tables will work even with innodb_encryption_rotate_key_age=0 * MDEV-17036 - BULK with replace doesn't take the first parameter in account * MDEV-14784 - Slave crashes in show_status_array upon running a trigger with select from I_S * MDEV-19060 - mariabackup continues, despite failing to open a tablespace * MDEV-18686 - Add option to PAM authentication plugin to allow case insensitive username matching * bugfix - multi-update checked privileges on views incorrectly * MDEV-19276 - during connect, write error log warning for ER_DBACCESS_DENIED_ERROR, if log_warnings > 1 * MDEV-17456 - Malicious SUPER user can possibly change audit log configuration without leaving traces. * fixes for the following security vulnerabilities: [CVE-2019-2614], [CVE-2019-2627], [CVE-2019-2628] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10224-release-notes https://mariadb.com/kb/en/library/mariadb-10224-changelog - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch- remove %{extra_provides} definition and Provides/Obsoletes where it was used. It's just a remnant and it's no longer needed.- update to 10.2.23 GA * notable changes: * InnoDB ALTER TABLE fixes: MDEV-18016, MDEV-18630, MDEV-18775, MDEV-18732, MDEV-18749, MDEV-18637, MDEV-13818, MDEV-17595 * MDEV-18878: InnoDB Purge: Optimize away futile table lookups * MDEV-14984: Regression in connect performance * MDEV-18936: Purge thread fails to exit on shutdown * MDEV-18272: InnoDB fails to rollback after exceeding FOREIGN KEY recursion depth * MDEV-9519: Data corruption on Galera cluster size change * MDEV-18204: fix incremental MyRocks backup * MDEV-18611: mariabackup terminated while copying InnoDB redo log * MDEV-18669: mariabackup writes timestamp in version line * MDEV-18855: Mariabackup should fetch innodb_compression_level from running server * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10223-release-notes https://mariadb.com/kb/en/library/mariadb-10223-changelog - remove mariadb-10.2.22-fix_path.patch that is no longer needed (applied upstream)- add mariadb-10.2.22-fix_path.patch to fix a path to resolveip in mysql_install_db script [bsc#1127027] MDEV-18526- my.cnf/my.ini: move slow_query_log example to the error log so it's logically together- fix references path below legacy directory /var/run -> /run- remove xtrabackup requirement as MariaDB ships a build in mariabackup so xtrabackup is not needed unless a user specificaly wants to use xtrabackup as sst method (also solves [bsc#1122475]- add slow_query_log example to my.cnf and adjust the logrotate configuration to rotate all /var/log/mysql/*.log files . This is useful when the slow query log is enabled. In that case, this log file should also be rotated (bsc#1112767)- update to 10.2.22 GA * notable changes: * Backport Information Schema CHECK_CONSTRAINTS Table. * MDEV-17475: Maximum value of table_definition_cache is now 2097152 * InnoDB ALTER TABLE fixes: MDEV-16499, MDEV-18186, MDEV-18237, MDEV-18222, MDEV-18256, MDEV-18016, MDEV-16849 * Mariabackup fixes: MDEV-18185, MDEV-18201, MDEV-18194 * Galera crash recovery fix: MDEV-15740 * Encryption fixes: MDEV-18129, MDEV-18183, MDEV-18279 * Fixes for the following security vulnerabilities: * CVE-2019-2510, CVE-2019-2537 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10222-release-notes https://mariadb.com/kb/en/library/mariadb-10222-changelog- update to 10.2.21 GA * notable changes: * MDEV-17589 - Stack-buffer-overflow with indexed varchar (utf8) field * MDEV-16987 - ALTER DATABASE possible in read-only mode (forbid ALTER DATABASE in read_only) * MDEV-17720 - slave_ddl_exec_mode=IDEMPOTENT does not handle DROP DATABASE * MDEV-6453 - Assertion `inited==NONE || (inited==RND && scan)' failed in handler::ha_rnd_init(bool) with InnoDB, joins, AND/OR conditions * MDEV-18105 - Mariabackup fails to copy encrypted InnoDB system tablespace if LSN>4G * MDEV-18041 - Database corruption after renaming a prefix-indexed column [bsc#1120041] * MDEV-17470 - Orphan temporary files after interrupted ALTER cause InnoDB: Operating system error number 17 and eventual fatal error 71 * MDEV-17833: ALTER TABLE is not enforcing prefix index size limit * MDEV-17989: InnoDB: Failing assertion: dict_tf2_is_valid(flags, flags2) * MDEV-17765: Locking bug fix for SPATIAL INDEX * MDEV-17923, MDEV-17904, MDEV-17938: Fixes for FULLTEXT INDEX * Fixes for regressions introduced in MariaDB Server 10.2.19 by the backup-safe TRUNCATE TABLE (MDEV-13564, innodb_safe_truncate=ON) and innodb_undo_log_truncate: * MDEV-17780, MDEV-17816, MDEV-17849, MDEV-17851, MDEV-17885 * Several improvements to MariaDB Server and backup for dealing with encrypted or page_compressed pages: * MDEV-12112: corruption in encrypted table may be overlooked * MDEV-17958: On little-endian systems, remove bug-compatible variant of innodb_checksum_algorithm=crc32 * MDEV-17957: Make innodb_checksum_algorithm stricter for strict_* values * MDEV-18025: Mariabackup fails to detect corrupted page_compressed=1 tables * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10221-release-notes https://mariadb.com/kb/en/library/mariadb-10221-changelog https://mariadb.com/kb/en/library/mariadb-10220-release-notes https://mariadb.com/kb/en/library/mariadb-10220-changelog - update suse_skipped_tests.list- remove PerconaFT from the package as it has AGPL licence [bsc#1118754] - use a new syntax for cmake variables that specify which plugin will be built- Add patch to link against libatomic where necessary and use C++11 atomics instead of gcc built-in atomics * mariadb-10.2.19-link-and-enable-c++11-atomics.patch - Add two tests to suse_skipped_tests.list for ppc * encryption.innodb-bad-key-change2 * encryption.innodb-bad-key-change4- update to 10.2.19 GA [bsc#1116686] * notable changes: * innodb_safe_truncate system variable for a backup-safe TRUNCATE TABLE implementation that is based on RENAME, CREATE, DROP (MDEV-14717, MDEV-14585, MDEV-13564). Default value for this variable is ON. If you absolutely must use XtraBackup instead of Mariabackup, you can set it to OFF and restart the server * MDEV-17289: Multi-pass recovery fails to apply some redo log records * MDEV-17073: INSERT…ON DUPLICATE KEY UPDATE became more deadlock-prone * MDEV-17491: micro optimize page_id_t * MDEV-13671: InnoDB should use case-insensitive column name comparisons like the rest of the server * Fixes for indexed virtual columns: MDEV-17215, MDEV-16980 * MDEV-17433: Allow InnoDB start up with empty ib_logfile0 from mariabackup --prepare * MDEV-12547: InnoDB FULLTEXT index has too strict innodb_ft_result_cache_limit max limit * MDEV-17541: KILL QUERY during lock wait in FOREIGN KEY check causes hang * MDEV-17531: Crash in RENAME TABLE with FOREIGN KEY and FULLTEXT INDEX * MDEV-17532: Performance_schema reports wrong directory for the temporary files of ALTER TABLE…ALGORITHM=INPLACE * MDEV-17545: Predicate lock for SPATIAL INDEX should lock non-matching record * MDEV-17546: SPATIAL INDEX should not be allowed for FOREIGN KEY * MDEV-17548: Incorrect access to off-page column for indexed virtual column * MDEV-12023: Assertion failure sym_node->table != NULL on startup * MDEV-17230: encryption_key_id from alter is ignored by encryption threads * fixes for the following security vulnerabilities: CVE-2018-3282 [bsc#1112432], CVE-2016-9843 [bsc#1013882], CVE-2018-3174 [bsc#1112368], CVE-2018-3143 [bsc#1112421], CVE-2018-3156 [bsc#1112417], CVE-2018-3251 [bsc#1112397], CVE-2018-3185 [bsc#1112384], CVE-2018-3277 [bsc#1112391], CVE-2018-3162 [bsc#1112415], CVE-2018-3173 [bsc#1112386], CVE-2018-3200 [bsc#1112404], CVE-2018-3284 [bsc#1112377] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10219-release-notes https://mariadb.com/kb/en/library/mariadb-10219-changelog - do not pack libmariadb.pc (packed in mariadb-connector-c)- add "Requires: libmariadb_plugins" to the mariadb-test subpackage in order to be able to test client plugins successfuly [bsc#1111859] - don't remove debug_key_management.so anymore [bsc#1111858]- update to 10.2.18 GA * notable changes: * MDEV-15511 - if available, stunnel can be used during Galera rsync SST * MDEV-16791 - mariabackup: Support DDL commands during backup * MDEV-13564 - Refuse MLOG_TRUNCATE in mariabackup * MDEV-16934 - add new system variable eq_range_index_dive_limit to speed up queries that new long nested IN lists. The default value, for backward compatibility, is 0 meaning "unlimited". * MDEV-13333 - errors on InnoDB lock conflict * Report all InnoDB redo log corruption * MDEV-17043 - Purge of indexed virtual columns may cause hang on table-rebuilding DDL * MDEV-16868 - corruption of InnoDB temporary tables * MDEV-16465 - Invalid (old?) table or database name or hang in ha_innobase::delete_table and log semaphore wait upon concurrent DDL with foreign keys * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10218-release-notes https://mariadb.com/kb/en/library/mariadb-10218-changelog - refresh mariadb-10.2.4-fortify-and-O.patch- add ssl tests that are failing with OpenSSL 1.1.1 to suse_skipped_tests.list [MDEV-17184]- update to 10.2.17 GA * notable changes: * New variable innodb_log_optimize_ddl for avoiding delay due to page flushing and allowing concurrent backup * InnoDB updated to 5.7.23 * MDEV-14637 - Fix hang due to DDL with FOREIGN KEY or persistent statistics * MDEV-15953 - Alter InnoDB Partitioned Table Moves Files (which were originally not in the datadir) to the datadir * MDEV-16515 - InnoDB: Failing assertion: ++retries < 10000 in file dict0dict.cc line 2737 * MDEV-16809 - Allow full redo logging for ALTER TABLE * Temporary tables: MDEV-16713 - InnoDB hang with repeating log entry * indexed virtual columns: MDEV-15855 - Deadlock between purge thread and DDL statement * MDEV-16664 - Change the default to innodb_lock_schedule_algorithm=fcfs * Galera: MDEV-15822 - WSREP: BF lock wait long for trx * fixes for the following security vulnerabilities: CVE-2018-3064 [bsc#1103342], CVE-2018-3063 [bsc#1101677], CVE-2018-3058 [bsc#1101676], CVE-2018-3066 [bsc#1101678], CVE-2018-3060 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10217-release-notes https://mariadb.com/kb/en/library/mariadb-10217-changelog- switch to libedit as control sequences were already fixed there so we don't have to avoid it [bsc#1098683]- update to 10.2.16 GA * notable changes: * MDEV-13122: mariabackup now supports MyRocks * MDEV-13779 - InnoDB fails to shut down purge workers, causing hang * MDEV-16267 - Wrong INFORMATION_SCHEMA.INNODB_BUFFER_PAGE.\ TABLE_NAME * MDEV-13834 - Upgrade failure from 10.1 innodb_encrypt_log * MDEV-16283 - ALTER TABLE...DISCARD TABLESPACE still takes long on a large buffer pool * MDEV-16376 - ASAN: heap-use-after-free in gcol.innodb_virtual_debug * MDEV-15824 - innodb_defragment=ON trumps innodb_optimize_fulltext_only=ON in OPTIMIZE TABLE * MDEV-16124 - fil_rename_tablespace() times out and crashes server during table-rebuilding ALTER TABLE * MDEV-16416 - Crash on IMPORT TABLESPACE of a ROW_FORMAT=COMPRESSED table * MDEV-16456 - InnoDB error "returned OS error 71" complains about wrong path * MDEV-13103 - Deal with page_compressed page corruption * MDEV-16496 - Mariabackup: Implement --verbose option to instrument InnoDB log apply * MDEV-16087 - Inconsistent SELECT results when query cache is enabled * MDEV-15114 - ASAN heap-use-after-free in mem_heap_dup or dfield_data_is_binary_equal (fix for indexed virtual columns) * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10216-release-notes https://mariadb.com/kb/en/library/mariadb-10216-changelog - refresh mariadb-5.5.28-install_db-quiet.patch - refresh mariadb-10.2.9-galera_cnf.patch - pack wsrep_sst_rsync_wan file to galera subpackage - update suse_skipped_tests.list- Don't require systemd explicit, spec file can handle both cases correct and in containers we don't have systemd.- update to 10.2.15 GA * notable changes: * PCRE updated to 8.42 * The embedded server library now supports SSL when connecting to remote servers [bsc#1088681], [CVE-2018-2767] * MDEV-15325 - Incomplete validation of missing tablespace during recovery * MDEV-15720 - ib_buffer_pool unnecessarily includes the temporary tablespace * MDEV-15764 - InnoDB may write uninitialized garbage to redo log * MDEV-15553 - Virtual Columns: Assertion failed in dict_table_get_col_name * MDEV-14705 - slow innodb startup/shutdown can exceed systemd timeout * MDEV-15507 - Assertion failed in dict_check_sys_tables on upgrade from 5.5 * MDEV-15916 - Change buffer crash during TRUNCATE or DROP TABLE * encryption fixes - MDEV-12632, MDEV-13516, MDEV-15752, MDEV-15566, MDEV-16092 * temporary table ROLLBACK fixes - MDEV-15826, MDEV-15374 * applicable changes from 5.7.22 - MDEV-16142 * fixes for the following security vulnerabilities: CVE-2018-2786, CVE-2018-2759, CVE-2018-2777, CVE-2018-2810, CVE-2018-2782, CVE-2018-2784, CVE-2018-2787, CVE-2018-2766, CVE-2018-2755, CVE-2018-2819, CVE-2018-2817, CVE-2018-2761, CVE-2018-2781, CVE-2018-2771, CVE-2018-2813 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10215-release-notes https://mariadb.com/kb/en/library/mariadb-10215-changelog - update suse_skipped_tests.list and add tests that are failing with GCC 8 [bsc#1092544], MDEV-16127 - do not build TokuDB as a build without jemalloc is not supported upstream- update suse_skipped_tests.list and add failing tests for s390- update to 10.2.14 GA * notable changes: * MyRocks is now Gamma (RC) * MDEV-14533 - Added the DISKS plugin, for monitoring disk space * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY. * MDEV-15333 - MariaDB (still) slow start * MDEV-12255 - Wrong result with innodb_prefix_index_cluster_optimization * MDEV-12396 - IMPORT TABLESPACE cleanup * MDEV-14648 - Restore fix for MySQL BUG#39053 - UNINSTALL PLUGIN does not allow the storage engine to cleanup open connections * MDEV-15249 - IMPORT fixes * MDEV-14988 - innodb_read_only tries to modify files if transactions were recovered in COMMITTED state * MDEV-14773 - DROP TABLE hangs for InnoDB table with FULLTEXT index (fixing a recent regression from upstream) * MDEV-15529 - IMPORT TABLESPACE unnecessarily uses the doublewrite buffer * MDEV-15554 - InnoDB page_cleaner shutdown sometimes hangs * MDEV-14545 - Mariabackup - Backup fails due to MLOG_INDEX_LOAD record * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10214-release-notes https://mariadb.com/kb/en/library/mariadb-10214-changelog - remove the following patches * mariadb-10.2.14-xtrabackup-v2.patch (applied upstream, MDEV-15254) * mariadb-10.2.13-aarch_compilefix.patch (applied upstream, MDEV-14318) * mariadb-10.2.10-disable_openssl_compatibility_check.patch (fixed upstream in https://github.com/MariaDB/server/pull/558) * mariadb-10.2.8-systemd-cmake.patch and DWITH_SYSTEMD=ON compile option that are no longer needed - systemd is detected correctly now (discussed in [bsc#1080891] and MDEV-8379) * mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch (fixed upstream in 52516706c86f9f66c76836eabde7e2477694bac3) * remove mariadb-10.2.3-group.patch that was just a half solution of the group support (missing server part) and moreover using a group option in mysql-systemd-helper was removed few years ago as it caused troubles because MariaDB resolved it as 'group_concat_max_len option' (see https://github.com/openSUSE/mysql-packaging/issues/15) - remove jar files from the tarball (used for testing from the source) - build TokuDB without the jemalloc support for now. Jemalloc 5 is not backwards compatible which leads to the errors in the testsuite at least (MDEV-15034) - update suse_skipped_tests.list- change %{extra_provides} macro from "mariadb_102" to "mariadb-102" and use this macro in Provides/Obsoletes for mariadb, test, tools, bench and errormessages subpackages to ensure a smooth transition from SLE12 to SLE15 [fate#323756] - remove "Provides: mariadb-errormessages = 10.1.25" that shouldn't be needed anymore- fix build on aarch64: compile a few more files with -O0 from https://jira.mariadb.org/browse/MDEV-14318 add patch mariadb-10.2.13-aarch_compilefix.patch- add mariadb-10.2.14-xtrabackup-v2.patch (bsc#1083087)- update to 10.2.13 GA * notable changes * InnoDB updated to 5.7.21 * Galera wsrep library updated to 25.3.23 * MDEV-13869 - MariaDB slow start * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY * MDEV-15249 - Crash in MVCC read after IMPORT TABLESPACE * Foreign key bugs: * MDEV-15199 - Referential integrity broken in ON DELETE CASCADE/MDEV-14222 Unnecessary 'cascade' memory allocation for every updated row * MDEV-15219 - FOREIGN KEY CASCADE or SET NULL operations will not resume after lock wait * MDEV-15042 - INSERT ON DUPLICATE KEY UPDATE produces error 1032 (Can't find record) * MDEV-13205 - InnoDB: Failing assertion: !dict_index_is_online_ddl(index) upon ALTER TABLE * MDEV-14958 - Merge new release of InnoDB MySQL 5.7.21 to 10.2 * MDEV-15165 - InnoDB purge for index on virtual column is trying to access an incomplete record * MDEV-15143 - InnoDB: Rollback of trx with id 0 completed * MDEV-11415 - Remove excessive undo logging during ALTER TABLE…ALGORITHM=COPY * MDEV-15016 - multiple page cleaner threads use a lot of CPU * MDEV-14941 - Timeouts on persistent statistics tables caused by MDEV-14511 * MDEV-14985 - innodb_undo_log_truncate may be blocked if transactions were recovered at startup * MDEV-14441 - InnoDB hangs when setting innodb_adaptive_hash_index=OFF during UPDATE * MDEV-14887 - On a 32-bit system, MariaDB 10.2 mishandles data file sizes exceeding 4GiB * fixes for the following security vulnerabilities: * CVE-2018-2562, CVE-2018-2622, CVE-2018-2640, CVE-2018-2665, CVE-2018-2668, CVE-2018-2612 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10213-release-notes/ https://mariadb.com/kb/en/library/mariadb-10213-changelog/ * fixes [bsc#1058729] and [bsc#1068906] - refresh mariadb-10.2.10-disable_openssl_compatibility_check.patch - refresh mariadb-10.2.3-group.patch- add dependency on which for galera scripts- change owner of mysql-test directory from root to mysql. It also fixes sys_vars.secure_file_priv running under mysql user (e.g. if ít's started via suse-test-run script) that needs to be able to create a test file there during its run [bsc#1012075]- update to 10.2.12 GA * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10212-release-notes/ https://mariadb.com/kb/en/library/mariadb-10212-changelog/ - remove mysql-community-server-5.5.6-safe-process-in-bin.patch becuase this moving is done in the specfile - get rid of the archive with patches (remove mysql-patches.tar.xz and series files), handle patches in the standard way mysql-community-server-5.1.45-multi-configuration.patch mariadb-10.2.4-logrotate.patch mariadb-5.5.28-install_db-quiet.patch mariadb-10.1.1-mysqld_multi-features.patch mariadb-5.2.3-cnf.patch mariadb-10.2.3-group.patch mariadb-10.1.12-deharcode-libdir.patch mariadb-10.0.15-logrotate-su.patch mariadb-10.2.4-fortify-and-O.patch mariadb-10.2.8-systemd-cmake.patch mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch mariadb-10.2.9-galera_cnf.patch mariadb-10.2.10-disable_openssl_compatibility_check.patch - add comments to the section with removing unused files (based on https://lists.launchpad.net/maria-developers/msg11028.html) - put rm statements together - install the new upstream systemd-tmpfiles configuration file 'tmpfiles.conf' and rename it to 'mariadb.conf' in order to follow the manual - remove the new upstream systemd-sysusers configuration file as we handle creating of mysql user in the specfile - mysql.service: remove calling of the wait function and let systemd to do this job. Switch from 'Type=simple' to 'Type=notify' and add TimeoutSec=300 - rename unit files from mysql to mariadb and add mysql alias for the backward compatibility [bsc#1067443] * mysql.service -> mariadb.service * mysql.target -> mariadb.target * mysql@.service -> mariadb@.service - remove configuration-tweaks.tar.xz and move configuration to my.ini/my.cnf file (omit default_plugins.cnf as all configuration here was commented out) - add a numeric prefix for galera.cnf file in order to allow users to speficy in which order the configs will be loaded within the my.cnf.d directory [bsc#1055268] - add 'bind-address = 127.0.0.1' as a default option to my.cnf file for security reasons (disable MariaDB to listen for TCP/IP connections by default) [bsc#1058374] - update my.cnf file and add a section with SSL configuration [bsc#1058374]- switch from deprecated 'net-tools' to 'iproute2' for mariadb-galera subpackage. This dependency switch is sufficient for making wsrep_sst_rsync.sh script to use 'ip' instead of 'ifconfig' command- Do not manually delete %{_localstatedir}/adm/update-messages/%{name}-%{version}-%{release}-something: The file is listed as ghost and thus properly owned by the package. - Use %tmpfiles_create which can cope with transactional updates.- update to 10.2.11 GA * release notes and changelog: * https://mariadb.com/kb/en/library/mariadb-10211-release-notes/ * https://mariadb.com/kb/en/library/mariadb-10211-changelog/ - pack additional mroonga/groonga files - change default charset to utf8mb4 for full Unicode support [fate#324329] - remove mariadb-10.2.10-wsrep_sst_common.patch as it's no longer needed- Added mariadb-10.2.10-wsrep_sst_common.patch (bsc#1069401). Upstream bug: https://jira.mariadb.org/browse/MDEV-14256- Disable openssl compatibility checking * the check uses CRYPTO_set_mem_functions() to set debugging memory allocation function. The setting only succeeds if no allocation was done before. Our fips self-tests, which are run from the library constructor, however, do allocate memory, so the subsequent call to CRYPTO_set_mem_functions causes the compatibility check to fail * add mariadb-10.2.10-disable_openssl_compatibility_check.patch- update to 10.2.10 GA * release notes and changelogs https://downloads.mariadb.org/mariadb/+releases/ * fixes for the following security vulnerabilities * 10.2.10: CVE-2017-10378, CVE-2017-10268, CVE-2017-15365 * 10.2.8: CVE-2017-3636, CVE-2017-3641, CVE-2017-3653, CVE-2017-10320, CVE-2017-10365, CVE-2017-10379, CVE-2017-10384, CVE-2017-10286, CVE-2017-3257 * 10.2.6: CVE-2017-3308, CVE-2017-3309, CVE-2017-3453, CVE-2017-3456, CVE-2017-3464 * 10.2.5: CVE-2017-3313, CVE-2017-3302 * [bsc#1042632], [bsc#1043328], [bsc#1019948], [fate#323738] - refresh and rename the following patches: * mariadb-10.1.4-group.patch to mariadb-10.2.3-group.patch * mariadb-10.1.16-systemd-cmake.patch to mariadb-10.2.8-systemd-cmake.patch * mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch * mariadb-10.1.12-fortify-and-O.patch to mariadb-10.2.4-fortify-and-O.patch * mysql-community-server-5.1.46-logrotate.patch to mariadb-10.2.4-logrotate.patch - add mariadb-10.2.10.tar.gz.sig signature and mariadb.keyring files - start building without client library part, use mariadb-connector-c for getting libmariadb libraries. Remove libmysclient* packages - remove baselibs.conf because we no longer build client libraries here - update %{soname} to 19 (libmysqld soname) - change '=' to '>=' in Requires:mariadb-errormessages for libmysqld%{soname}. Versioned libraries shouldn't require regular packages with '='. It also causes problems during update (Problem: libmysqld18-10.1.25-3.1.x86_64 requires mariadb-errormessages = 10.1.25, but this requirement cannot be provided). Also add "Provides: mariadb-errormessages = 10.1.25" for errormessages subpackage that solves this problem for the current update. - pack new files, remove mysql specific files - remove README.SUSE as it was outdated - package cleaning * run spec-cleaner * renumber sources * reorganize subpackages order and update summaries, descriptions and groups * tweak and add some comments to the specfile * remove warning about mysql-packaging repository that is no longer used for this package * remove checks whether we build mysql or mariadb (we build mariadb only) - add galera subpackage * add missing "Requires:" (lsof, net-tools, rsync, socat, xtrabackup) for proper wsrep scripts functionality * add mariadb-10.2.9-galera_cnf.patch that enhances galera.cnf configuration file (add wsrep_on=OFF and set the location of the wsrep library) * rename README-wsrep to README.wsrep so it corresponds with the other README names * move galera_new_cluster, galera_recovery, use_galera_new_cluster.conf, wsrep_* scripts to the galera subpackage - remove the following macros definitions: * %{_tmpfilesdir} - it's been defined in systemd macros since openSUSE 13.2 * %{preferred} - we no longer need to distinguish between preferred and not preferred version (we build mariadb only) * %{with_mandatory_lz4} - mysql specific * %{build_extras}, %{pretty_name}, %{build_readline}, %{builtin_plugins} and {libname} - they are no longer needed - add the following macros * %{run_testsuite} macro that controls the run of the regression testsuite * %{ignore_testsuite_result} macro - when set to 1 it ignores results from the regression testsuite (debug purposes) * %{with_mroonga} macro (enable mroonga build for x86_64 archs only) - rename %{with_jemalloc} to %{with_tokudb} and enable tokudb for x86_64 architectures for openSUSE and SLE15 [fate#323280]. Don't enable it for SLE12 (missing jemalloc dependency) - add the following BuildRequires: * unixODBC-devel to allow ODBC support for Connect engine [bsc#1039034] * krb5-devel to build auth_gssapi.so plugin * libarchive-devel * use libboost_headers-devel instead of boost-devel for TW. Boost package has been split up and will migrate to using multibuild. This results in packages that unnecessarily build require boost-devel to cause major bottlenecks [bsc#1062583] - do not use "BuildRequires: lzo-devel" for i586 and arm because it makes build fail - add the following Requires: * hostname - as mariadb_install_db depends on this tool [bsc#1060110] * libaio-devel for libmysqld-devel because libmysqld depends on libaio - tweak build options: * remove "DWITH_ASAN=OFF" - this option was added because of mysql and it's no longer needed * switch from "-DWITH_JEMALLOC=auto" to "-DWITH_JEMALLOC=system" * use "DCMAKE_SKIP_INSTALL_RPATH" - this allows to link with -rpath during build and fixes quite a few test suite failures. When installing the file -rpath is still disabled, so this should not have any effect on the installed binaries * add "-DWITH_LIBARCHIVE=ON" and "-DWITH_MARIABACKUP=ON" * remove -DWITH_BOOST=../boost/ as we use system boost now - enable OQGRAPH to build (openSUSE only, SLE is missing Judy requirement) - disable Cassandra storage engine build as it's no longer actively being developed (See MDEV-4695) [bsc#1055165] * Remove "BuildRequires: libthrift-devel" and %{with_cassandra} macros that are no longer needed now - disable make test (Connector/C unit tests) as it requires a running server. These tests are part of mysql-test-run now (MDEV-12470) - add suse_skipped_tests.list - the list of the tests that we want to skip (they fail correctly or the fix is in progress) * adjust mysql-test-run options to skip tests listed there [bsc#1041891] - remove mytop utility that is packaged separately - remove *.jar files from mysql-test - remove python scripts remains from tokudb upstream - remove generating of the MySQL NDB Cluster filelists - remove removing of manpages for MySQL Carrier Grade Edition - provide a symlink for the my_safe_process executable that was moved from its location to bindir - update filename in /var/adm/update-messages to match documentation and build-compare pattern - README is now README.md - fix "file listed twice" build error- Also Require: libopenssl-1_0_0-devel from the libmysqlclient-devel package- Drop INFO_BIN from package because it is not needed and differs for every build (boo#1047218)- Explicitly require libopenssl-1_0_0-devel, to successfully build once we switch openssl to 1.1 (bsc#1042632)- update to MariaDB 10.1.25 GA * notable changes * MariaDB can no longer be compiled with OpenSSL version 0.9.8 and below. The last 0.9.8 release was in December 2015, it is out of support and is no longer getting security fixes. * MariaDB Backup is now beta * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10125-release-notes * https://mariadb.com/kb/en/mariadb/mariadb-10125-changelog * refresh mariadb-10.1.12-fortify-and-O.patch * remove mariadb-10.1.22-xtradb_null_checks.patch (MDEV-12358), a fix was merged upstream * update file lists for new man-pages and tools - switch from 'Restart=on-failure' to 'Restart=on-abort' in mysql.service in order to follow the upstream- Add mariadb-10.1.22-xtradb_null_checks.patch (boo#1041525) (See also https://jira.mariadb.org/browse/MDEV-12358) - switch from '/var/run' to '/run' as /var/run is just a symlink to /run - fix permissions for /var/run/mysql that were wrongly set to 700 instead of 755 due to added umask. This prevented non-root from connecting to the database [bsc#1038740] - change permissions of the configuration dir/files to 755/644. Please note that storing the password in the /etc/my.cnf file is not safe. Use for example an option file that is accessible only by yourself [bsc#889126] - set the default umask to 077 in mysql-systemd-helper [bsc#1020976]- increase required physical memory in _constraints from 5 GB to 7 GB in order to try to fix i586 build that fails because of "Out of memory" error- update to MariaDB 10.1.22 GA * notable changes * XtraDB updated to 5.6.35-80.0 * TokuDB updated to 5.6.35-80.0 * PCRE updated to 8.40 * MDEV-12160: ed25519 authentication plugin * MDEV-11842: Fix a 10.1.21 regression with failed INSERT, BEFORE INSERT triggers, and columns with no default value * MDEV-12075: Fix a 10.1.21 regression in the InnoDB data file extension code * MDEV-11027: better InnoDB crash recovery progress reporting * MDEV-11520: improvements to how InnoDB data files are extended * Improvements to InnoDB startup/shutdown to make it more robust * MDEV-11233: fix for FULLTEXT index crash * MDEV-9734: systemd compatible bintar files now available * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10122-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10122-changelog/ * fixes the following CVEs: * CVE-2017-3313 [bsc#1020890], CVE-2017-3302 [bsc#1022428] - refresh mysql-community-server-5.1.46-logrotate.patch - refresh mariadb-10.1.16-systemd-cmake.patch - remove mariadb-10.1.20-incorrect_list_handling.patch that is no longer needed [bsc#1022428] [CVE-2017-3302]- update to MariaDB 10.1.21 * notable changes: * Innodb updated to 5.6.35 * Performance Schema updated to 5.6.35 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10121-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10121-changelog/ * fixes the following CVEs: CVE-2017-3318 [bsc#1020896], CVE-2017-3317 [bsc#1020894], CVE-2017-3312 [bsc#1020873], CVE-2017-3291 [bsc#1020884], CVE-2017-3265 [bsc#1020885], CVE-2017-3258 [bsc#1020875], CVE-2017-3257 [bsc#1020878], CVE-2017-3244 [bsc#1020877], CVE-2017-3243 [bsc#1020891], CVE-2017-3238 [bsc#1020882], CVE-2016-6664 [bsc#1008253] - add mariadb.te file to the filelist - add mysqld_safe_helper to the filelist - refresh mariadb-10.1.4-group.patch - add mariadb-10.1.20-incorrect_list_handling.patch to fix incorrect linked list handling in mysql_prune_stmt_list() function that can cause use-after-free error [bsc#1022428]- Replace systemd and systemd-devel BuildRequires with pkgconfig(libsystemd), which matches what the build system is actually looking for.- update to MariaDB 10.1.20 * notable changes: * XtraDB updated to 5.6.34-79.1 * TokuDB updated to 5.6.34-79.1 * HeidiSQL updated to 9.4 * The limit for the table_open_cache system variable has been increased to 1024K * Galera wsrep library updated to 25.3.19 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10120-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10120-changelog/- update to MariaDB 10.1.19 * notable changes: * XtraDB updated to 5.6.33-79.0 * TokuDB updated to 5.6.33-79.0 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10119-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10119-changelog/ * fixes for the following security vulnerabilities: CVE-2016-7440 [bsc#1005581] CVE-2016-5584 [bsc#1005558] - add mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to fix mysql_install_db.sh script to find data files in mariadb directories when a user uses "--basedir" option [bsc#1006539] - switch to xz compression instead of bz2 for the following tarballs: * mysql-patches.tar.bz2 renamed to mysql-patches.tar.xz * configuration-tweaks.tar.bz2 renamed to configuration-tweaks.tar.xz replace occurrences of "bzip2" with "xz" in README.debug- update to 10.1.18 * Release notes: https://mariadb.com/kb/en/mariadb/mariadb-10118-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10117-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10116-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10115-release-notes/ * Changelog: https://mariadb.com/kb/en/mariadb/mariadb-10118-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10117-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10116-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10115-changelog/ * fixed CVE's: CVE-2016-8283, CVE-2016-6663, CVE-2016-5629, CVE-2016-5626, CVE-2016-5624, CVE-2016-5616, CVE-2016-3492, CVE-2016-6662, CVE-2016-5440, CVE-2016-3615, CVE-2016-3521, CVE-2016-3477 * fix: [bsc#1005582], [bsc#1001367], [bsc#1005569], [bsc#1005566], [bsc#1005564], [bsc#1005562], [bsc#1005555], [bnc#998309], [bsc#989926], [bsc#989922], [bsc#989919], [bsc#989913] * refresh mariadb-10.1.4-group.patch * refresh mariadb-10.1.12-fortify-and-O.patch - requires devel packages for aio and lzo2 - remove mariadb-10.0.21-mysql-test_main_bootstrap.patch that is no longer needed [bnc#984858] - append "--ignore-db-dir=lost+found" to the mysqld options in "mysql-systemd-helper" script if "lost+found" directory is found in $datadir [bnc#986251] - remove syslog.target from *.service files [bsc#983938] - add BuildRequires: systemd-devel - make some dependecies switchable - add systemd to deps to build on leap and friends - add mariadb-10.1.16-systemd-cmake.patch to allow more (case-insensitive) values for 'WITH_SYSTEMD' variable in systemd.cmake - replace '%{_libexecdir}/systemd/system' with %{_unitdir} macro - remove useless mysql@default.service [bsc#971456] - replace all occurrences of the string "@sysconfdir@" with "/etc" in mysql-community-server-5.1.46-logrotate.patch as it wasn't expanded properly [bsc#990890]- update to 10.1.14 * What is MariadDB 10.1: https://mariadb.com/kb/en/mariadb/what-is-mariadb-101/ * CVEs fixed in 10.1.x branch CVE-2016-2047, CVE-2016-0668, CVE-2016-0651, CVE-2016-0650, CVE-2016-0649, CVE-2016-0646, CVE-2016-0644, CVE-2016-0642, CVE-2016-0641, CVE-2016-0640, CVE-2016-0616, CVE-2016-0610, CVE-2016-0609, CVE-2016-0608, CVE-2016-0606, CVE-2016-0600, CVE-2016-0598, CVE-2016-0597, CVE-2016-0596, CVE-2016-0546, CVE-2016-0505, CVE-2015-7744, CVE-2015-4913, CVE-2015-4895, CVE-2015-4879, CVE-2015-4870, CVE-2015-4866, CVE-2015-4864, CVE-2015-4861, CVE-2015-4858, CVE-2015-4836, CVE-2015-4830, CVE-2015-4826, CVE-2015-4819, CVE-2015-4816, CVE-2015-4815, CVE-2015-4807, CVE-2015-4802, CVE-2015-4792 * adjust mysql-patches.tar.bz2 archive for mariadb-101 * pack new MariaDB 10.1.x files - remove '%define _rundir' as 13.1 is out of support scope - temporarily disable OQGraph It seems to need the boost library with the version not earlier than 1.40 and not later than 1.55 (MDEV-9479) - add "BuildRequires: systemd-devel" for SLE12, openSUSE 13.2 and openSUSE Leap in order to enable systemd features during the build of mariadb-101 for these products. Otherwise we get "Performing Test HAVE_SYSTEMD - Failed" and systemd files aren't installed. - re-enable profiling support - don't remove HandlerSocket plugin [bnc#979524] - add 'log-error' and 'secure-file-priv' configuration options (added via configuration-tweaks.tar.bz2) [bsc#963810] * add '/etc/my.cnf.d/error_log.conf' that specifies 'log-error = /var/log/mysql/mysqld.log'. If no path is set, the error log is written to '/var/lib/mysql/$HOSTNAME.err', which is not picked up by logrotate. * add '/etc/my.cnf.d/secure_file_priv.conf' which specifies that 'LOAD DATA', 'SELECT ... INTO' and 'LOAD FILE()' will only work with files in the directory specified by 'secure-file-priv' option (='/var/lib/mysql-files'). - run 'usermod -g mysql mysql' only if mysql user is not in mysql group. Run 'usermod -s /bin/false/ mysql' only if mysql user doesn't have '/bin/false' shell set. - don't delete the log data when migration fails- fix constraints conditions for 32bit architectures- fix information leak via mysql-systemd-helper script [CVE-2015-5969], [bnc#957174]- update to 10.0.22 * Release notes: https://kb.askmonty.org/en/mariadb-10022-release-notes/ * Changelog: https://kb.askmonty.org/en/mariadb-10022-changelog/ * fixed CVEs: CVE-2015-4802, CVE-2015-4807, CVE-2015-4815, CVE-2015-4826 CVE-2015-4830, CVE-2015-4836, CVE-2015-4858, CVE-2015-4861 CVE-2015-4870, CVE-2015-4913, CVE-2015-4792 * remove the following patches (applied upstream) * mysql-community-server-5.6.12-srv_buf_size.patch * mariadb-10.0.16-header_files_const_warnings.patch - add mariadb-10.0.21-mysql-test_main_bootstrap.patch that fix main.bootstrap test (change default charset to utf8 in test result) [bnc#937787] - add mariadb-10.0.22-fix_build_denabled_profiling_off.patch to fix compilation with '-DENABLED_PROFILING=OFF'- update to MariaDB 10.0.21 * changes: * https://mariadb.com/kb/en/mariadb/mariadb-10021-release-notes * the following patches were processed upstream and are no longer needed: * mariadb-5.5.28-hotcopy.patch * mariadb-5.1.50-strncat-overflow.patch * mysql-community-server-5.1.51-mysql_config.patch * mariadb-5.5.32-upgrade-exit-status.patch * mariadb-5.5.41-mariadb-admincrash.patch - use syntax in mysql-systemd-helper that is accepted by both mariadb and mysql [bnc#937767] - fix spurious macro expansion in comment in specfile - install INFO_BIN and INFO_SRC, noticed in MDEV-6912 - replace readline-devel for readline5-devel (MDEV-6912) [bnc#902396] - use spec-cleaner - Tweak some cmake switches to enable more things * WITH_ASAN=OFF adress sanitization WITH_LIBWRAP=ON tcp wrappers ENABLED_PROFILING=OFF profiling disable (for mysql) ENABLE_DEBUG_SYNC=OFF debug testing sync disable (for mysql) WITH_PIC=ON by default we want pic generated binaries (for mysql) - set cmake options for MariaDB Galera Cluster - remove superfluous '--group' parameter from mysql-systemd-helper - make -devel package installable in the presence of LibreSSL - cleanup after the update-message if it was displayed - add 'exec' to mysql-systemd-helper to shutdown mysql/mariadb cleanly [bnc#943096] - remove redundant entry from %{_tmpfilesdir}/mysql.conf. Using both 'x' and 'X' options is redundant and causes a warning message. Leaving only the 'x' line fixes this problem. [bnc#942908]- Sync to git state, fixes bnc#937754 too- Sync to git state fixing few triv issues- Enable testsuite- Update to 10.0.20: https://mariadb.com/kb/en/mariadb/mariadb-10020-release-notes/ * Fixes bnc#934789 Logjam Attack using 512bit dh groups in ssl - Sync the package to git state, redoing initscripts to be more robust- Update to 10.0.19, sync to git state of repository: https://mariadb.com/kb/en/mariadb/mariadb-10019-release-notes/- fix parent directory has insecure permissions error- disable optional features for mariadb * still possible to use them from mariadb_100 package- Adjust _constraints. 11GB is not enough for ppc64 builds, increase to 13GB- fix build for openSUSE 13.2 ppc bnc#921955- Updated to the version 10.0.17 * Release notes: http://kb.askmonty.org/v/mariadb-10017-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10017-changelog - merged patches to packaging git and regenerated * few fixes mainly to upgrades- README.SuSE is now README.SUSE; fix name in some places.- Fix undefined initial status in systemd script (boo #914370)- Fix include dir in alternative cnf files (bnc #859345)- run spec cleaner on spec - update to 10.0.15 * Release notes: http://kb.askmonty.org/v/mariadb-10015-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10015-changelog - conditionally enable more storage engines - updated packaging to the latest templates- fix bashism in posttrans script/bin/shmysql-clienth02-armsrv1 1725036999  !10.11.9-150600.4.6.110.11.9-150600.4.6.110.11.9-150600.4.6.110.11.910.11.9mysqlaccess.confmariadbmariadb-adminmariadb-checkmariadb-dumpmariadb-importmariadb-showmariadbd-safe-helpermysqlmysqladminmysqlcheckmysqld_safe_helpermysqldumpmysqlimportmysqlshowmysql-user.confmysqlplugindialog_examples.somariadb-admin.1.gzmariadb-check.1.gzmariadb-dump.1.gzmariadb-import.1.gzmariadb-show.1.gzmariadb.1.gzmariadbd-safe-helper.1.gzmysql.1.gzmysqladmin.1.gzmysqlcheck.1.gzmysqld_safe_helper.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlshow.1.gz/etc//usr/bin//usr/lib/sysusers.d//usr/lib64//usr/lib64/mysql//usr/lib64/mysql/plugin//usr/share/man/man1/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:35430/SUSE_SLE-15-SP6_Update/6184e569227c549a034fa764fd3e0171-mariadb.SUSE_SLE-15-SP6_Updatedrpmxz5aarch64-suse-linux ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=c1c3a29916cd9e36f78d0ba81f80c6de194113d9, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=eb9cef6ff1be5bcda79ad361dc8b597210559a50, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=94458b3b06142d6bb5c67f5794ff70cf425d6b63, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=7c1e99bbb6000d260da690b65f7934bf3ba1882e, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=9ec7c00fedd54850ecc73f3a737193dd5c8de565, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=65be9ffc6a694ed6df907416befb02ee2923e8c1, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=dfda91beefb8e12ee76b4bc17ee5db5e324e9267, for GNU/Linux 3.7.0, strippeddirectoryELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3469055041f3c4e271c9b3523a394e2a78983256, strippedtroff or preprocessor input, ASCII text, with no line terminators (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)#0=JW^` RRRRRR RRRRR RR RRRR RRR RRRR RRR RRRRR RRRRR RRR RRRRR RRRRR RRR RRRRR RRRRR RRR RRRRR RRRRR RRR RRRRR RRRRRRR RRRPPRRRRN(,C|Jutf-8d64097bdbba109561edb92ccbd9abdbe2b435914cc5e4f5bdb8081e4c8282420?7zXZ !t/]"k%-ASDui0o%@I;tpoF \\mxQ~場kLurU-AY]f~Ɉ$SVYoF]?2?"58&PS ?[᠌QröB"fgփmrIP[(1 Y^Mg|;_lD nGm q+1:꿣֠QT4v RfNJF u@)_4x1XAoCX%R =u^H<~+F &=0}ދ%[ڔ%-浃ʬ1\I =Lc_tкGz3#!G=V4%TO\{*tTq E`¤dMbE%a"dl .oDc!ćIrA3$# T޹a/2֊Oi?s8-|o[0c1x$AizNZ~P; 3=7 %y=f=, %p !#'{Xw z]~k 'FW2]r1rJ@Ak[DuӲ\h".ĭj_;АǍ4'<6^H UwZR `2gc'i!ԉ=[O_YɗU8NiCX?T_9zėuM,+*-5s"U}( 8=Gb-vrI%DJmd͗rԲV +Ԏh;:Rꌧ^ /;=īb5Ud" OWvF v`G~ ̣Eo[/egi|@O̎fmf=;Oa9k3v})B DĬ]7Wd~[˹e0T{Y{0jw΅ɵ!4Cv1Ƽz3s_iWw@{=˲RfԦb_`S}Qu.B2N! l߅b sB6! k#m֔5 Y<bBzO_(C烷>:Gtݾy) 2ƋM 7(t7$so"${OYi S6[ >2k6=%.{H'peO'( '>- 8`bU FʴٴtidBIeGOV\>IKOL#sMɓ`ƧQ@ǍlbWyMԪxwO*::9y!hMxX'gz%GG rU4A{:)*w~\i"0K`s9=,B%EYD쒹dfquTtFpuEk /ya8L=xAjh_8Gqw"06"} #5T\.yaxsq[_fBI4;zn{TB7B]7or 허4Q D'*+Rq>մ$b;6qmq'V4t+w o/f$^y乃!ǒZ9fcFBvv˺[-'J .bFu(aJee?O~ h9!V3v:$lC5dGv[tzzQ'h,!ue"5J'd]0HqY9f2P[~,x5kcA!ur8bqҜQ;mi+^D< w̎HKCu d,esAq](OgEXhCct'EJ JMh~17gB]/a(PEH$wd].8Im :hORG%Gٍ )T*'']VP|2xMni| PH "*–&V%BObIK?pq~+g"O!K9ۄ[ z2a4poՑ,lj[E߯@VW~Z{ E"wD*[gЅ eF3-,WFUK(WHีː.w\AL(+3,( Wv!!Yrj]_12~%drN [JbZأCty:j<@;{jwIK:ɢor(y*[\ݙXH;#uZ__q+yl%==DN֨11Tpr.ywq(rPxjhw^$ x n4L(&utfïqI)X[T[ȎgqBg-6Ӻxb4cL@g&M[5m=f/.ai 1cxج*=}](ώS/$Mn(DSx%՝1<+ge4J~}!ߗ]([ #M3BqkvVSV]|*=tDBJ_9y,O58X_~s.Ow)K< ; e$Pm>q?0ӳ*-[juu߹^쌶݉F~Nezbwu&AI^kZL=R|F)!hz[ޞf^]/HePI ݦa \J9:*DXꓪ\v?i}t71,>P[*%(w\N NزB,Rtws7.4\Y )Wˆ17+g"&})KR f" ߻aid"/^uWSžOY}"=3ĭ?_/Z /e46!~9QQ;RKX'O"ׂ*kqy.uR+ ,}zT3x8AbRPirqwDd:>WDW6P<'ֺTGn`ꗠdW'hog^\2o$됬NwWYYVc ?e?@LԩuKg[FX۪4@2MAT{1eW q;;|Tj5)Srw{bգ0MOG` 8.Np+6"=yb|v5%Oo* uaΪV/ǰߋ3]tl> #φszy¥ e΃w]~ߵ~%?7(1?0tƬ]5cمWb/{QFP@s'ؠQߤC7G&Ŋ=wyUU>[fg9lkeܕ$×d1r:DžIِ6(oO?ʃ40@亅-"Hj! ͠u$!6!h?XLBkč]aMSJ,A'dY.X JaL<~4xN $ &,]YB;X+< ZA=Oң45>u!.QCW~"D$٤,Qz*G/$;-afB+ R$b`c7 ZHly:2TgDy. ;bJq#ʇnqx6j#b \a?=E+E~W&Tqiz V`bdfnbbAp 0&ZBGfrfF%,X0 ZDA{/$[>HWf9Rcp̃,e-|C?ա0o:5AЅ+vo@a*cPA"ž2sOc#3X7!֗5ySgU|r!8>Gmp& UPe.V4tٱ>vRTYJI!:D .{4˩EE@xTP&$VTj.wIa NCr+E0`~B#6 P'c-BDuɂgEnnRy&u R\<N5@3p (6S{^HɴRGַ[dLTqen}e_ѝ ZҎooƷ%`"P!l-ֱwnޥ}Q5?F ڲ/ N??ŀ Iu7 ˢ3惭b*rB`- nf/Șo> ԣg(M׭h"[ @R`F ry`>Gz+Әp#_Q7k-XjnEU֧|B"Z|JhCo%J;#6W . _!Zl1N6E+ju6 i.+&Zyzl+r'膣.TUS&; p`w#kg5*zZ ,SvCgȠ\C)eґn[A)!)&Ԓ9K$9ql:de#es"|R6u'Έ vX]܄!Rry2Й:@8▲A=]wL-mH-qӎ'͍)W|1M4"pALdݡ <˜֏ ,ԟD-ʛ:(chqR:[ }>fqz7S+ý_92ڊdwDȸv,["2Wl_()|I6p+!GOH@PY &j5nmeBz$w6QBBA)R`I1]p;.2/zN@#)~lY?i80ĖlKc5?[OZ\H"s\0|i7}!ƓWe +~1>Q%${wT~'N /. {x{m<#,'m8 *`Y!=U-s$b++M_m+_znSڊ#A* A<`*^04}[ԌLr0N@DSc4*R k6Sm6# !/]SX?[:2~YxbPIdnNh3}Ju6|uIuRC4bN9&zfZsc8J0?G}Y6:!zai'2l)*Z;E˹S(I"H)K;~Z,`R?K<}K;;%{n *qżгWw9C^(zR |h7ϧAJ3c:%02:Yfq ЙD EyqFbD&_) Yյ hԷ"B\ON"{k}*.׻Fc|SנLڪ 7:$~kWpvcu}$ ?UHkqŒKϐ=j䷁Uͅ{tH[<$ȽIٿZpF*|k+D X,gT':g|M@~L/YhO\'kd1!?9ʜMyI}LM2'l3FӋ6q#_hҗW-`wg&UmDpӹ+$27֛OO-̩/T5Ĕ!|j- z6?YgMAd¾.G-"t語?_v}u<@ڜV; U3Mz55:a.h?_Ԩp+@Ve.7Wh^K7`%9Wg_fѐk߽ۀ[ErothY.U.bHzZM&WJXAjօ_btpTЄGCSLO@*Ek탥,]}h޶jƈlLC(4kUmN):}d|{Y:acXAJ+AN^@Í*mO7Yi ~|@Wd1&0Dg 6@54 5|tGF9{"M;g`Iߠ#6/lT$Z<>FO9t?iv 9`KFvj/5^elh4#";`耈\C.Gs5 3?d4$'sdERHHUU@~"ȐB1QfL!씾I ׯkK"U RQM4t2ߵ]Px :̨(\xbNZ邝c6VցxԘ~Z{3DXssf>`;*Gpjvwmv酶Ljd#$YB Eቛu Zy0)7DzZ5K7#LQ-'֔H2LNMA3%{5[awB: W4I2Ak[cB` wA*س=As]:ߌ[-9s߇YK\ Z`{)f#SF" kZj|%>"8XJڀb \WG1GqWz 4mH|O:!!I((SB>Hû"z3H`]I躙ʙ#;>60x;5FOTo32&&vX70G07*Ss"s^m4]=/ `LF* gԞHƗh4dk!X yʦ-0KlLiNmE':]N"-+glZT؁>:'?1?@@ ettSQ$_;ޚa3vDc=[v&9CG2bpxhOJ/ E8CIT8r*AKv{I5;gZ~9锱I?ʔͺf' 4{ϵ}>3!kl~:RoZgJ/Sj<|) Hkd1e`$x|64Ɛd؈fPbPq-gVD7aOVhtƸJ]* 9!s._Ir Uώ]b10ؽEW=>!=[V%EqRvOq&бgw {I/2hG`pVL|$ PB\yIin#C9Hvo_*u|ؓތfOZٚXP'_&;{ɒrLKg_07-ˣɑ)IADƱvͯseьAꆤNK=vzr_eb,䱒e|L2)m,SEf|p ġk9{S{gqEÉ~@ [J x[~]vNϻa'̑TCU_&*' #\B ӏfCc$˧+lMD{G qy;CKqd[X"zQHe%=GZh {S4QW.w Dc `-/hd5K&>wnlN,[ie? So*[4XgwG>#?lr NX93z%QN^K78.n?`90E~Lu]ЀBBk֜$^khoYƽMӛp}_Rz{tvB⪵&'uBJݳ?ru~J5xY.bIa8[Qv>W^lӸɿKvRdǀ꼸8EyF嚗Zy%Ͽl663]&D4#^=R\lxO(zg׹h6Y NjA &;ÆEߺdKx]J a 2&£E})t߲K)Ä쩈N0np} R/rכ玨L5Z0|_j)qF<9 ~a] fx!%=agt#vH0s2xlGSP2F-PFo|}W$-oe!M; ugB=9Z]gWU|@XE:] rG6q9<3!!rmBh@)hYʆ"pDIj :%kJ'q/'X?9KDvoBM\NQAŀ66\|FM^ACٓonӻȰ},5/1ns 4wkNOTS-ࠆCvĪ􇹵Niq>TpUeľ7a(Q' L`z+ADv gE8rL1n/=$ qX͝GgC L(+([pNߟ^8nAVvM/u; _=L1^0u{ӿm̘[἖Г4s-ʰ4ELNlMɡ}: y[m$SRB1$̱vIrZF2ux5.sŹ{!Od 6tʤ$aۧa거#2c3ҮëJ;)y>3e9Op+(o8,Ȃ_98b\6&0k)ŋ[yxJ:~yjӉ@xH&4;Y7 ލ0ޙ%B. g݄Hc-·H MDz!L5WDH0 D۽l'-ʁ1~(Y+uNVlʐnǭv b4՞IcY߅"L@v~+,bགSstXk ^1Ph "O-An ^! 'Nhj>~' (F@-a+ [c2MK*/^ß8FDy똓~Оt`mN_$'#䛱ʯWݬߨmG"rw؆է_dF]O ũ+ų.:J6bbGѢL*gZuIz^V+vfi7͎UCK G# 4Xue _xONOD|SFu7DI3"[={GvaQA1ݮRmR^?W'- ]]50׮+ZF6{& tTb]plY޷L!R ސ]PD=~Ջtd4;O#=637uR/VQË xUp 1B[F/z=4 i>~>Uo+\R/)U| D2+K$Ň0RgE" iVϠv;}ʷ"Vktm幭]4 G;kRYaw ;Nƚ`AMa?皥)ĨLZz o51GXnZaN7gsyի[Ͽn+5l@> bVH,~qA hSL].P M_@bN-JLTNvF9Udyeil2xLfegU.>ڲ0DJ1(F46#Ӡ*Flu;z]waW9VXyp'SIFE!ܽ$^||]LxV9 ) FF]G#UOPPscHI/ n<#iv1;^mf e9o@`=LI_m9;Go?Fgz d]tͩrat@&ɪjHJFi/n?aW FE!Q+9!)Xn[ˢ#GL#Ǫ 2I&e{A #MYNS̑ff, on1z)-y+jg՜To;|g(1n]>)]IhL^ɨnmR;Gk>g쉲&K 圐YW-)P;vP~p\n?DgmW{&Jй r mtCQ,9X9.lG$N0Ԟk53?BnNi "p(WC.< @Ѭd?>m3kLF-tF{[R`nHs )qn5* ˘LZX-Zq< Z6ߣ@CV-N8R lUo\foIB^K\ED3vEEQK(q򼄝>wȷ񱐏D>M( Ko6?tYVG5qx.rjH-kKHiG\^3bTgɽW҂ <]a@ Kjѝ]I?7^i`m'dX(bkA 8>5mܻSe#!-u0@ * t ]+أ&E::r4G[ލhyR= d5%ܝhbޛFmU]/J6o044m. 5n72gLH.[,0T<ҧ|RK5|KaS[{ñ;Rn?O6ۗgh ص)g;9iN,ėN-DX^'4\+#x@ĭޘQ,hB+Ð ,0ʟy. &*o~$=<HZ[ AwmdNN:2BIq=_ 2~|9UGG7tҧ;|N ^!l=<]0r;B\59_xMWW88x[2Xv5v5/&X&eȹ}%Ee[qE+ qFEtg(/cO"hR6IfJB D0-KsuV ut/ ul az8TuA޶qcK:bs dIBV(x /nG2i'=7x5VNaDL!@!/$],]79ytrzHM`ICI"8ȳ&`< RE^:N&p1 1Bđ>(#=`/9%?E`A4"L^YrסlF=;aEm`FY'@cxJ_KzTG۸#kֵoZ0,=F$,劚-?zU!hKCBl۹441AJ,r+7ͼ^@웎Q4@"g^I+ Ѳ2)Lru8gL40]YlBg7mP sD)4XO9E)euZ%J-_/Ken'kJ>nen; x+ர0fq#kg|5 cY>?,#×Ȩo&\CLn2s]rPgsCX? #3,!zf ߕ͵ƙ%s. _i-cG24unרiPR+^{3­т "ŮZZ%V2A=c$6wQbGWaE-Uw#7mSUpRȾ~O%YzO+CE͉dʸm}7JrzM WXgJ}ur3F;]8d'!6W7{=Pë3\ 6=+L gbg|Pvڴӽ@J;V-BŦ|Gphlr3z@֫ͲeO d`OsBGe}3aS,?c*G9V"p vnuTa$R5ϲe?`g)i GBz u;lg5m %82P>b2bWMREOv ta6.pv6IN;ͅrW!ԧo6?ߌ,iZ۝uMgZf/ 6r4$ Au눣-$}œ$9ek9^^My唥 6n&tDY[cаӚl(0@z'i6 ͺ^_bjT DұD쎀J>4N(ߴ߃BdHZ0DtC6%g.դĿ=:q",BHG"QHUz7[cd-0Y'+-&hJZ,|,58!PZ)_Pڔl Jv?ww=سs716֙2@8zbB5.g4HO-'HԄ_q5G! D)I+6t drD6X&c; Fu n q9_'#*#s_gѻ'4kRKlX)|p;  Ҋ n ,;CVYϓ.HcdZ-ɔo4f!6SG.A4Kf˱;}(yP Nj`e ːcȬO'mvkFO/?`>)׀'"S~YMz(hyKS~b {Ǯ$p:5b_׎O"_8֓ C\ T蔙psc= jA"rM߾xe"mM;.Յ ?un+hXļtq췆3OW 扜Y+1‰Ub GZh}YNHTs%yCdp>v11[,IFpw:!%cJ2Ȩ*R3%O! O9*'wnq#@n5ZE^Ι?d~$M!jF)5R.BĿ\~.fd7fEBtn'.oUm , fw~]V.uvcxv#H}q敇գE}~nq7e39?d]"ҧR}s+C`[r- ӑWHt0JM1lN>?;4'eg ׍ D Epk[ƺQ}SuU16G!kٹiwKu8z%9ż;8پ1@D- hLFu^RjRE7-NXm,>BɬROv.ƬI{2q[\3:/U?9Y3uw|{S8g3%FҙskYz dntq͌2?2ȘFgzy7)'%U8M~P=S1ŅvU:{)?@褍Â%X~#WwUF-o}ms.r8Q"ƴԀ9)x!8)*>lvҼôuKKcO@f-䦟 w-iLQ5j.#I! ~v(*PYbPk˟JS?P R8{&Nqe[He/oT^tl{Nc"i 4J2_Qw/L+[ж wW A -龏p yV8 ]))НÃɻ=#PӲ?N;$- {\[Aߤ"'ƌPˡH hcV\nEihxͶfh)xlM9yPK x;Nx.0 ̭Wp\0_f=مkĂc?e,ߠ+ZS9Quyo8Zf3A޳G1Dﯜ&6Ǘ5۟EƢr}"77Qҹ-g`qV=̈{" 6$S%wjN Ll3h 1!TSM sk [MAᲂZ蘵K-Y^Uljļ[=@Z`=")>7&蝚OS-j0VZ82 /B_w'?s[sh1m37ei} $~iy:)(+ɖ] WՐBSӏK1P\I9VBpU)\ D^{DŒGdh&.?(gprHEp9:< ?3:ooHh7 [SسG* [vwG[+*<ֈ IY :ǥ 7@vGdFɼzxx@h!OR86`39tRPY<_.s80⵵o'V>';d|E6(j/MA`x'}~[9SVtv!JPN7:v&+taޘE*'e6.ġFGc4jŚ/hj ou8XFj^{hAY9E@"7 $}};}Rߝu)mJ'oc6kwf}KX%* v%xyQ/@[i(ei(3ټj#V`ըRgHP^ܷ+9FΚUz)橸+bB-w*F xzVy \,WgU(ūbӥO[v#-7vM]}ٓmP@5w]ZIeңF@M.Zf{`h`tضz3%b3 /~]2B`tsVp ;tu~{׎V1hB>}Nѕq;{z'{T46BiΠ67ye %\TA,0U9TD-6 bx,8L@ms o222C!R">i6 r$-ūvgk(if7%Lb'E4;e=gM'Tsk͉En(\x>[W5j@0y"3LQٜ+\ ’;4O?ڻHW,`uu Fϑۇ] ` )_9LesN` ~Tc3L3k..'dH/ذj?6*C\6Y^9cq4Zz۳eĹP1J.N/6h$a'4z\4xCRĊ<';56onfDyIs#-eѯ0C3UTDvꓫ*y/_#iQt\[4DVp`>#1)? ~_PV|ӳV1/EwtK@h&1)2g0RQ0Lg詘>CCmZ7ڎso(`ޕp7g7jga1QƁAiP|uc44Z1rY<Rq]&(Aw,$'e@M>mXg]3+rtE \Ќ9ɧ3w5:6+iEbM7M3`{/i@E3üE5BX#5&m@ @gX!qؓ<|7G,tp򼍲*K<Ⱦ)/R"+nBO٨؍Tgz \W$d<1qz@FUB-Kz=7'0o^Qa$#ΐnkHZ2~L!+*ꮭ5B+U` Ks-M]= xhH{*5Ot{,os&6[Y@dƙıa5G|+Q7 I yhJ CY+ = }*ߧrFlfYdcVXY<^`Ng3e-!i=(XnPr ^G"|Uzoפn9rf^3֕Z3y_ &卣c"捌 ISJ390kXUF9ػ,%^ +1{M?gv`a~}K;.֥IszJ%ɩoOx9B&#=gZo*CCC؜Vdө}rYup*JO 5%<]9*)y8 $R&,ҫ"GJ/1OxM_e\EE6yЭH]ݏj 2YphGzj jS섏FU,@ d ?!obٷcƜ;̟y"l3԰jƕCdz0i:Hmѝ zp[@B=%̚oZ= )Zl@K5 x~20uAL!}Иf@9a fj)1 {+c/`Mh|5`cEQ nYU;w'q+B#' rw< / .=0.JA5O5][K4-"g8u79㯯z"OjLOQ-4L gF)p GDLwe7ᙕnj?h`Nqۿe spI' n^6dŰ!2BUܩjñ @#_勦Y+u$#R8PZBBىfW)TZ4JL98U=4`ۘ@j5X\hK5P!^y|W~(3UP{FrvgnLjH7ogΛ$BV=l]k@X-ÿO4W)% 7-j1<ʝgltږ?-ç=S%Içzim( a} 1O|Y/w.rV,ߒ*N7l M̜DJx ^V7")0& NHq&~Pm=Ty#uVUEA1gƎj %/#%c~kװB"Efu\qBQ_ TSt lO_t.0U(:p&2O} G^@nݧ-}߬ǃ+Z3Q&!QR/y DԶ͂@Yq*)E:tSFj}D@=LUkjRĎnyK M&#ϼ{%-/k5)jʳ M;PQxͧYP@&X~ ":1s2hդͼ'VWr\-vmkOB?Y*Ȼy}_ #yi-5BQ6^1O==ޣ#dy||HG6X80WO2-]_HV7?c URũO(._4syCE3h9{Bjb -`;^P5((Wl!;fǗC{E3MM OBr…A늘&|=su=9[\WP!DĐE)1W?ǯxGw{}Ruɭ܎VKo5<;r,\1 6$|7S{E"˔)]vl!bMv LKgm4.;ZB)bqmoP+F<\~I}דsB ᴊ9Pւ@"JБrDkBb>iY9;]"ϖ>Mr57q Qݱ $z $;N}mQsVP <~_R RZհU< ;oU!w<@-@GU}M"~P_qF.'oьq0ۺ=:2r1) ?; 'L('9 45$W7`Ʀ3 w-GDHs6LS7OVk{}g3 ٭ w xGؕ;RUd;[%~I'7@w0ёHg<[t&MH $ܐsliuτ?'=XmүĎxSbtiZM3T("vzD8#nu07! ׼:3ii00Q)YBK]R}lg +bY!ͭcOu]{Wzs>mNe+C͹xeT8jթ9oEYL`XR) H E$`!M3[#+ZA/ .zZz~X;P ԚTThF{z{RNK6rH c/^I,Ȫ'9Naban5ynYȕ;C$FBXOque)6 ꬓO)yw`#%q,tRn6k/LVۨsBHtdYƱAOe5o1wX*XJ"ĦT(K ʎ#n-[URjc}QB{*/_f3$Ghwlص}o]͐MblQ#q;w0TA'Gݴ!nx@vL~ xɴd@FZZc8*5+X_~c Ū;D Nȡ&h<_zSE #,!Օ`V/sLERf\M *Es[GEXrV ߅ηϵ\MV&RqHkV,ii%yH u2_Cִ{?`JݮWDoDhڃ74 LĄ}@F e 8L(0O 3۴Pq}3$ {"^Г?q4K9oC%gAEXm)|4LU8rǨ ݮB~ tMiwo9U!k<\.My#Z؇i@[4r١YbG|oq]/ '(u2)le՘ Yi״]GS҇σ]k5-bʀEFgΟ3Àtr\Dg\qzKi]9uhqLTTg2\ehD-馤U}Y5.Ҽ\(dກCAz @$ wKyAXn6$3cGvnRc)QJm![t ` n nhNB\)RĘB:,%4ȣ7n`<%ѹ=L|o6[DKWq~{*%-+? ]C9L1r6(.UQS"S"j1)t,.oqBo'7ax|)9"[s?x0#9V-Lڟ Sf'C})%z%cН5O =\D;s"٬gT$ꁎJcv ovb]<9߸>{Sc |Բ/f4nTC5[ s)[YBz.dުog.1OGS[Jaϴ-p}bH9T>iZ(i;Uno ':ʁ="#eΈDNwRgn-u4?n2\c!;h慠WryDdr% 0`jc|o;{&IT~g]1Bv~PK & o~AD?vI%r8ƓQs.# <60fR}qXGRnk\r_XE%X^P2/ӟ9*|-8x\`ߤ%ǖw!rsC>* 4 ~P^xï-#zL+2W^Dbaԝʓ:s p`bz2c#vZV 4 λ+{55=&ODJyۙH#Bq5B?XHv :荄̖ݼcqKěneؾ>M`S{'Iqyz+@5bptpޥEs/BcE.<7rSB XE4WYn!n \ u'ݱ6LU#@z('zu=)2!)~ptmg;[^b)ެu;Qg'E| s(GxE>Wy-A8 9K4c@|;Hj4 yzP?Нݓɤ &\B*꒠td qu~FEߕŐejD9 ->!?wLX8͘1wK*rc$ӽ`o},/Ӳ.\:hwvcsZ@46"Zجp=d2nfۡ?*{Eid.Hr c:nry4ձ/ފ~OO)V |~/D1V.]|C^(l{s!=]3vP5γ:q_N]XÇ\2sͪzc9Ot1@vױNaӤS @*zt&jXoH4*C-/+1~vU>e4>ҍ"z*t:+Uq{JT`W"VtiyUFLjP֌y8Dyd $Ê^0 vI^ޟ&?te @Z/v`EW5,Q_╯\yMà" };7+ɖ'՜cIPKчX jq8D9!(umN&E"FT𷮺yC7֘ˆkSJqvL_ oB~k|@$D|TgȢ:$By{΀pXws) `4ӂaQ7yh;F/f/]dZ)k[ٵAe0kY;[OHvNKqI 9t;k{Y|=s}qbJ_d:ر#yNXi\ 4&؍?z1}"kKH*vɕ#Woj@' Y&{O~}{eY_G`K"^ A5'A0өG*ز(t8u/ Ke @jXG/ÏAS21fW6Y00][S54.  8]ǣ ,J™ά 7NB_[֙uk6fه0W\&Z*¢zˬ}"^㓪{ : л&-SW2NAvlZH|(?Q( ,FWAڴ+M߄X|å;`)N OŨg~aW<\*'W~4 WSo4цoÚm hSۻ3KUT[.A)s#HzBbB묀g]QH ^-N$yvMLM3V N4 p^ҩb߀Up >0Q$h ل0{.a 6Ҿ $`kn2Em%.!]΁Ns+$蟹ll. G_8h> ]HGbYO0Ef\6{LJgޚMa( $Ab'O *ȁ ;ku,œ9Z:4@$GƗoBbo=mILgMY܎4+ڟ$H=,گ4)vdhhMKD$Dm= Y5nű&ܓ5D }4 Ry DQ/:_r[ҫi3"ng}و)B*IFp5υ̠oNS\%z_]`AmL6:+S>"Xn?tD?1o/kRg&WwlcYŽxϜَZ<+/ؤ"6l9  A+͹Q #y@셂V`dsm^F? ;ܝ:tj *%_iS٘RL|T$KREx;٠7Lԣ04ݸ~0gCSZk_Zy} a.@PH kp4(!D&(EI +qSq(_uS7`usr㿊\oWW#PH닜B{ng%`8 aVIJ;q:`\^5yYH 2οv4+o'#` MZ*cS>ImΈzevMwGv޷kw J' W!KGhA1Eu^&} e;f s(Mzd39n5nnzJ?》g@vx#~*29=LI9-/I?Z .pߖBR:2|6[N4r"%? q9:V3}dX ^Tws}s5^X5ޓ/-C O;T30)4rJ8M *q&dCW.b1qu{vCnZ#BϽT"*mPzW)O5i;S`{#C rBvVrXMWz֞ݘȧw u%1DI,Hef]g69"Eoͥ+Ҧn,Aͬ?({4Q~T0^mdA1M-nѱ=,9ku{\{N!3cWa[s++_wi{ŻKOs1Az<Sg nf20+ e ;HXόV1|򐛮kb `a+O  I6llN2MZX &m-ӰJ I¾-{.BezVY.I+D y;ɳÚz#u'jHӓuoz'pv>2 eΥZew9g7Tk%b;I&D-5ylҜ6o!eE`D.K72Ւp[+:]+حęD%3P)dJva~45`(Nl?4ùôYQfUB vgafMY\]eڝ~-*Fxd.yOsyKpCVY]"Ж>dڒqL- @9,CC8W3w ReVT2|g'#W" h{w!լkcd's}9RS_ K(G(HTo`+3dJ7f# xG yypBۭ]0gA$}e5;0om^ĊUq\?@1JZJ(tm,|~⭁רҺ1{ TBZ'j :zu܅/G|7@}fZ V^4yGC_H V_?i蛯 &@4rqiC>EV&E H4U+3dD^JCD%_,N{I9:rs׈-UGq3~q* iQi8}4=sDyi頕!Ed&. .1{MtDU:?8wk޲t'`N|uqRp ,s1CMd j>u+X> ˕aڍ7Ul>cb߅pu* }lTg{tQ'6m8" SHy|pӯ7$MA'N uB V17yN 1:[BePm w{E[0 U ے&e~sz>7 Gx"!&U^Aò$: l]'e)G qN3Ϛbɕx6nU Ȃk?+At猥\a#Z?\ժ]rNd'^Y+CJI_^VTմKY V ](d2x[MeJg2;oJ'ǧ%˲R"B֩؀OaxNM[=%/?>'6CD u% =.3˿'k+>a >Q/Ó&w'0mBkti{ DbCmWhu ‡+o,w2@k(бpG@If >B,Ȇ5p#,ƪEW0Kô-UTf(ռNI61o!3H$7˘Qc*5Jsـ#,i {DW&x…n[ю$TNy&.0+AJOIc+24T>4RV4e^$yj#vtԏ=dKZx={4Ձ8Np/ C̶jJo1lrTP6d7@/xaNZF50Ǒ4֔w=uF|/0CCw);oPx A|~|. "|/B.J>ie2^=՝#*" b[FXѲ %%;B2K6GFfDzk%zi Rqir;q3c}'"b#L1v:׼Eբik\ $ؕuA\p<4DlJ0=-6 6rel%t WlBx uyWy`HY*b %m4wZHc!ob^DDjv:x8Ǥ8-T_ca|nPד$Ʈa~1Mu@Yo$ZږS0,d۩:>y߼RX V(Zpt%⠩g%g2JviLHb gr$ s)l(ST #Q1^bx2WvOє8W!c k~ұ~\o"p(I" s(G7#Stbrʇ$-3(RSwՅR#YWVƼ(@I;u V3"r?Eq6c-ҠzMIV)PTw>XE66 X-qHOy+l3)ۥyX )a-c7']'ED9bn~I)"}Nm~A$[ɲF `B6 Ҡ0UNW'3}t֭ V}n3 >=  ᥀$G1&gbAV%_\)vs5ǃ܎#ܼ\l̼#zLB%W0*%cAWKC _MJZ+4Pftf&R\qu D̙S1-n2'# &D2m:4Y.C*o=)4ț&8uFք!zU]V:ނxqۑ@ \d/%oz3xb3Z_h$[%5%`Z3(j'9iC#t1 -5zM[{89-v/TEfh+*8y?ĊeClCNlSl1V= +Utb]0 ت5SW7y;gpz X&M0E?cUX$?*&~L!KAMNyCu'?3"󄌏RFCIJ4T.̀:]m1&n tstk+j#x0@+Ab_ RXQ yx *zc5,Uf?KϨ nGpw}.*SooW=Mke[èC6-EUhtT+MgƦbgˏ_ 8:E5ΨwS:F*~r|4)iՉyGYJS{ [.EBD՞BO/}l|ce &"zݪ.OS:_u2 M==D+c/᜝95m;a+x!nЯ[F 1mrCXVgcl<#rqT^p|YB&"0.&"nebɛDJjʹm7U0s>HߐΟ Dm5|C^G^%FLg#`*KqPR@.].'y"z|$00pc<8>"m%g){1nEjbo/cW!_l#vןLIsZuIO4`uC؝깨`1Wiq^g_T^ڟ@u$ZEͳ$H.7<73)P0nH9Nn,z5զlnN lb梃i,+ xZ-f3?qa<3:hS2 (0ݝ7,gWt )681Vaz6rj(⊾Nt|B'e %3\z)Z+YnL{)(b1dG(n4o_g|DiY|:sᚽD2/TUbWiXDe kz[bE(0\ko'-g)<l3sظ/C6~ F=O]EkYm+VKeȅMtNZXrV|^ˡa}BLӚܷL8weZWEMy9#O#IKrl6BtLVE@*uY"k0duRi̥J:ԆjzK(` Ru~` FNgf0LD5n׋_ZPd239?k[.Kp6_,jewt>wwnxVc: >?gt`ZuHJߢB`.Zj#?P=(`ߴ3=n N)Ci268'fYy8}d?9dmwQM|Zb|o'=@҅p}pX^'K);>%[}4DL2 g%1 aKf@H"0WQ7(554Oy\CpBDu)z» 5,NM %tR/^,Xcʜh[7{=|ۥ)YVVdFѼ_X:*ݐg*drtd_.$KQtҏW n$cX+%R7RKOW{Z:eqz>6GoɶKZݲGCoL 6o!>a/17h)T$^y UgFZfrDTu* &:2jNԱ,;_6Iԫ~kzmC٧Oov >5;e 4ۍ<]k|0P/4襰abO<7@,jo(a͝rxUpP >3o)\qg1O|d iHxGV?lU-fPOz7EAI ީe2!Y_U*Cbo,]g`C@״l5@SR>D 0\hz6='+[$ u İv ?qVWFxG%PJȄ,PXzl2]2%ۚfQl)Ixщ;O~"԰X<)9A߾g 4Rx 0w 7~h%ՎQWԊzPXXLk>)_(ΗIAS 4 J04~]s+I1?b8THt7lɖ80XK{| Vyc~Wp+ej$Y mY@=*L W<^ $uʅ嚚6_)kpX vgK@S\'E|_`pPo=n:8t-fdi=)+.m&wƁeR,Փjlmf4 ҤKc;ף:;`  @ɍ ͵|m'Ɨֹi+C)}hoU 5G)%`Z)5I*.'2!'))I:h;+mf^2e?u59pC]ſGHL wV䲋T1ߘ-+zlN.0CU{,;cB a'x RѺ uf!+kͬ"Kk0s qIw64=Y˵K7t{H| 1sG{60XyS5'0j 4x'@xnRm4|5|/X;r뻘P+BPz97XO6mѱ V2ăwOy7Eל/ DȲlb%yM?hKzLH0l"Mg5UQ!N(s׍#p)sOGӍ8!RJ#a\'9 H69l^/~h |Xq{+coܒjw Qh8N {0ե R0U$blá *‹ӴflxA k"ZAW\'Ϻ3>$FF]J|3WpyJ-O Cb) رep/(I`FQv>`;zSK~vMNe `k)Y>5gmsliPP66L/OEy=Ձv:WEQ9j`m֩9rVV,8a lp77g9rEE=ĥɀ15F,OA jT0]~;{ȧ?F֍|18<1_zL3#K8G6fPLV=XyQk4_yBT;Æ -dzlQTJU֩J3\p^l9턪%`N,{&Ոob:oEN˜FPXiܠA;I{]$~-ݛS٘Zf+֊_x"l@p3Ge^l+.! @9 % i?ɉyioM0ӭ6/҆%o1Kqyhzͣ4:|g\Z>s-2r=NtQmA̧qEkg&Ճyfb8`XZ8"׍\E D!BZso ;r?`:DLaznJz㇓ UfMJgAz&(;-`n jhjhLr4{dEcirVK%',Ə<Q/TFYӚڍ(>%2,I] xa[sjƮG՗h'b@!ķ/@ <\\<1J6۫f2׌Cr & j}.'TZ$Y'ZQM7ïoz)dF-"Qf0tKuIlN7(X3(AASpu*WH :Y4P+A箙7C 55Jj..jemѣj:`+88w' /Gh͚U?*l{0Tu^5q} *e9-;? iKx#ms_ 3F[O2Ǡ4')j9ʨW!$+F/XEdicŬne@. V{s+gh#@i͟X_އz[-| = xgJ1$?IUbGvQZULYtxMВlUf'|+pQ>et%)jܒ9BEJ ZE*S Ʊz\Vu}$Zdu)jeǃ0C4F tnb#WnZgkzsXOdoō(Pp z[؅;<ϊvڪ5eUI48Smݩgkcu)U07徸5-G0U/L$9y`i&\F+Qͯ^5'z卻I@ >t.⡑%֯sNϰ vdWfC۩8]wj4 >?-ldF's+Ra8Ra:/hR6d5]wd x:YGeeҌz".8(l+`JaLS@ =J+=YH/98=sXJd<㙙r>K3wdYy< v?78Tベk䂇s#ʫ"@P1֭>9$Et Iy;>rlcyu+uDHlafcz ŧ ߜ6k-L|ZHҴdp.#JkZ7#EzHu2ٗv+j 9Rڲw)DT G0q,%ID\Aڭ7SBU([IW(7'WYuE8&p 8k7D!0!ɪIn5K3K?(9,P^s0V\FXl9T[`01^~4"&D@Z/+>$_zB_HPp]q<}K߸TcRwExaU0C? K/j$~1LoLmD;o. >}QDrH$./Z *'L<ƲjE'%-~j  ֥x,qqV.qC"&eYa]\[8Lнavia}QEdQ`I{tYSA݉IIX/G 1n 1ή\mQr~V"|N:x R@p;iW wŁu 8r3@A蹈K6ݻ^݂ ILcb5w:k6P6pu9 jgQ OLk0zKZ)ENؼ,3$:ը҈߭zBkdRx x{LB=z %6f_.e\GZ֭-i>( 2)ԛqYKI.}^}a .Q1$3*et|YAAKY+4{ᇧG{-粔"[)YK9f3"E3 kR"֮Mfg; ?ɑ(ژ^ntPr *z|8I皞i)iu"`-lR3룄FQO/A@nDn$N`U Rݷ6~BVWf9tSAGrEHnXvUtC?쒪ӘiȀV `@:_޷,g7/{4l  /9M/ (;۞헊zĝ5Q:kjt#eyeM3xXGn7͐X"0iemUVz{5)q#2"[ |_5saآA'1y6ه QRLZMH>s2i!h &^ezoRe,qye,?tʅN9hai:w5r< B]B7\nXY#ɜ0E)Nfh>eKu-.r|>mg".;Ukzv{ِ}&߇h,_Nt 7,[ȿ)RPYK+qϡ Mgbˮ#'/]ON\tF EATp~؃1kOy,ixy;qJU҂}r`Z7n*+Y)кu1VYgxqʪR$U uKUc/UUKrL+"ⓩ/ l\NyyGUEouh#\ɂ-4 tɓ)K|@j)ڒl|"`)am<57)A(6 :nd(ܣ6#>{jb%@3%̅ԊSq$meVK@Kt[K4>fl d:D?*R#CLPuoY$_4̤ ~:.ZnҎ uϡ:\SB`96| ׊טM&u(t;fhB^jV51$\7EltV/o~*ikA :$K Vcgb$Д0ֽqcfSg|#{1ߚ n)x }b=ۗf?˙{%<~<(?" WKDU)ϿbhTz`|ocPr/̌nPI붥],6DVV)&CњNZ X E|N=XtV/ z/ R%J+jC (ňē&P>>hi*^sR[+ IyPfʗYK}mlPJjT uC\ "($toBieTB8QTɬ7qE ?D? !jkT.f&b8뺛|6dҌ|TgJL[vٓ;w5fXPmXE\Z-[fzC;.%amE`0A(s9x{[[ST2ɘk9yV@n^~)S/1U5Y.#ms/_iW;glZ{q\g@ 29^#)d!J5]M؝XWdܽj5XėeeLG }=_O^ԡׅ+ndNN[SGzJG1no ̰̓o7hPB"qyVHx*!D+6֫n_HhGG,Ԟt:E}]) 1:ߚג=r Ec>7 SxH`<Y&o75R~ܐ (DȜ[rÄ?;o|},$F`}Rx;^G_zW %ܯ/ɉU'T\+3]1T Τs(THOwKFi{#"~.=(wcfK7ZFd>{$h|{A> X0KJEr2FYҴ`Cꃁ{gi8Rq3F`^XЎ 8tyI~te'pLpg^NLϮXxnv4l:">PlBeeHlsiggBWE\R-8Bj,.fdKh 8S^gXM.lMEj$ΩJj]XޟhTҐSt-wz™6?~s?J(|ko(^r~A*E(5jg漉b j=u:;p!붂S0hLb*46[I76ݠ s< zJꑉϥw,m{ RovUO0K]Dʒ ND+$TƠbvlZ(A@^AhbWLׄaT^HN2̀nPPlw$mqu h_6o 0@qIBK^Hϙt,hA<c#ݏ*ׄ0R*XeGG!kVGk@lQo4(N? k)n!/t݆{hj<,+ӈ=Zn҇ Mts_ia~~XM)$p|ӟ2 6yr !4c1X,d-8Q8aOG\ Wirw#/ƹ>gߗ/ipƿSg?e2wn^5&ٚd)!s2_W=(VL4WwIqHB6=txS;>f*6DYh0.]o>Qak^Dm ͖H#>EwQXͣ1uܱhd1k{=UӮ\orCvo>= e\(Mz]kLtbk3)$WVA%M}X@͠J'PH{~M;*f8D ou:##$ƪTb3KR'[5-i)Чjszz=i:pD|TnRrƺ5Uv+09e3ߡhG%VdY2I:Pꁟ8P +©f)8&YJ͉XQۙZ d{v凮5`j0vڹ͓=g$F9$Pღeڋ1a.`{7闾Q:aG y#fC+r1+Z|O XAFeG!:K,4il2w^WhMi:vg^ۃACdMJ9TxB];MצAӺ1'p0o'qA8—j!eq33*mFiKGGv`Ե7s|B6aqe;vUTpى+C%w*-dXi@b*kٚ>(HٍزyJs1%f% ºdAWTb*/irj8-eR?lq+KQj5]Fn_G Q})*k`pGx53ݬmCO?'‰xC T _Wi)YjPG~HTb¤'mFEKss]MagiiL8E:e1~Lmc[фjs(J,ǣZ;| v-uA3R_k#u||31FO \(C/mz]?g-2\LtSוśoRJLGe`.\Q出̣ #+KJTa:i8@\ru'IwIfx$a% il[SΜ ƶEwNjLnǝ~9$i(Y5[t|`q!LIde?<{tޛЍYsEh`zw]M (I|8NA_GShot DUxd!Y䧹,?x6K ?TDփcZMzPOGo27A lN ,&BX2OEa}|zۓJlqcf IJX$(0řK?HLr;9<*lD m ZO! j'UQwN\y$-jV~!=</ߛ?JL /u ,&CVCw=z[?4@oװvN PRI%VpIIWN82x28Ö|a ># NsN ]l iH\,0rfģ nފ膺S Lϋ< ]#Az @4S#s8~3ح@vk(S]Ǖks&sZYӉ\`SSMm)wFO^ ,@rO>RHg/h`Iuƛ5Dwp@LEv`0Ƞ\a08LF y}nyH@oT*ԭz8r.5cgmWhXN:8ЩZ:ӻrxq$jXHyMA!es/&gpocl<).ק-{ Ozzo~:TdkL_<ǩ(#1(9$i}e5J+ RfOεk|̀Ń2HLؼيoe r(g#Lq?&NPmJ;/Ғf_ Ӟ"+BzkP!YxDF1Rgs[yn+JSM"z'at/&Rߗ;Brz=Wv|t3_]} 'g^7% 84vⰀۊSXgts%}/h ";*>`9I?k/TLZ0-~0Z=-~㱻HVT` >.3Ikx#S嵣c=wWC&-Oz^1+=Ƅckpw9\uUݏvZFy#OuK1R ެ㴪[ AVP/z~-x>z݊yt.-6W>N&R_Eg͋4;M]n"9Q:lխZb}N/Yv.dGN)VSeFhxgMe:jw #h.د A>~_Y`BYk7'ҡ/I0!S̤"C=ê|MÈ_`ӳrrUD]ћԖ迗vDYm*83QUTB$2Lz}KfU ){guAWA8ԩGzzAq%+'E؂1+ݵ)^(w -[9+SeV9bb[u'vsR+[OOrT}4|F[&caOUR.+zy̳4rmK 2j\OWi/P֢_tg+HIž7 |>w U$H}VynN `0D[8݌Q\cKi)Voޫ[gBn C6+b^ۖe-U [+GӦj>C,n/>+\.o?T~€YS辶E0T+Jr?R-9m}}t/"}*d>Ͻ$[kGy/@XI勫SMpv&Pٝ@)\CZtss:qH34'~!{g$B<ʀh\zjM1U& 3l@ Jb%/w?'YElW[Ė8ll fb $ Ksʦ6.rMz ǢV%׫P.d\g 3>Zȕ3%W[TA^f5 Tz6wz Sw\O#cpq WU,Qw9rM!24J@YTVgi8Ctyj{@>!7WUY%۞FP|%9͎3vE<<)"Hz73,bNk GLqB4ͼ -'&Q*.ƞNc fky Fʘ's_ZLyɢ[ގ~r@@DN`OH ? O{a( gL92?G(kSbvtKCigLh,rꓸcဌdG t*NLmpUXIVEe,; %cN @>p<*/K=%8- ?v³)9qGey %+pd&9O{S e{c/8acc.e[`۟+ϗxO񫶣#)Pw1dyc#K R*HqR#UXN-Yއ;z )axTbB)^a.:^5ѨBu-(SL@zA#M+cAьCpFI]ZĻ 81Mf~ !%\r\7kw]7N^ f|1o\U!fA p }L&>I|Olow2N y'62hX%E\S{+]$R(8z7Z^ 32u'#2qKJRn۽i醚xW̻МI@yn x$,΢#*S\n)cb Y+f;bPB !pf xJS mjL?wX~[΄%kL L: _5WjraR bE_vX3;+aNvf8Rj!V5C{6J<[SK #\z|p%%Y S \EOwL@,"Ly}ߴULu!^ؽKv!}Dhdo ĩFa.%Z=J:ߐv ;olZD1^,ǣvWfnX  !3kf@]*>Ԓl+˜ڌ5b~S{FkW&V@lzB>{MW0bbaŒMhASadjK&LԮn$h?,MNn8f#7ךb?-]-\(9'yJ YaĄ(q,L)0]&pcG>=1&R|c+iO78)Lx2/:ա6x 2TA(?vQp͏*#ٺ\44-XYW Ҩշ::E^{U}C&5i!Ѡ"{ߧg.&ʣfm6_޶b/iЋzDNB!4t1d9K0.{ RKj!9{H!tm[VqYw\]V#8o%Ɗvԧ0퉀~n(c|7w7Ö#,#Ɋ|4r(R7ݧhN M_[*=J9r5RVD/k$yyf[dʼn.%Sh Sȿ0D6q}RSeYJWC}:gŚkd1}elmw&ӿ(c\_ebٕǐ7<*K-2hZTiCٳĀC#^}*׋p>pOK^/8.U͢ nMDLXƪ9c itQ zvWK Hť>qs4g:B4_g0]O$$ &Z oc(\UREeucN[0E.sN޿5$,Y^w {x; V>TeCj <-5r:Io*UGB[ )B.uM?7lL>YT9ʜv Ѝ_jbGvW|aWÏ|$;Ftd089u=ʁOhY)nv/COF?3Z$d,t+j{;1zUFHJşD+n8q;IT.bVp`'>'o0m~ O+4Gu;XAB?BݲQrld I;'6Ӂ,ozJӝnKnn=!xfΕ E2AzrJaPɸߟmg+p;ihky{{jq3cL?sup2YҜR8Q<,Uz3#Lsi^\@nJS(W=$Dd$5S:Vt%sc*$^<()7'cUL+KJ-@e~0f314(fRJG=!Q|՝Mk(gW Sϊ |$nel5@qzWNs+XEnԲgVAd3 D1ʋT а̝Erbr_Ezyf1L[Y2sb>Y x@LYlcn& V+f[B^ڏBI#16.4/IfD*[ێm Dh%;Z. "vήU-Z@өV(6@(n;2Q2K. k{5sCw6jJ=Gė_]FXڷ?a-A5){M*8rN"5D^a]uOi{b.(=:"Q )q~mD651H$Nˈ\3lmh}^=zTL_^<u?{c)=Jmq yddu15S5|a/NS9' dQp:.Z^̆ PHO<kоdZKSH&-~Nї6DrA6{sȆ>4U?g"ü|jf: >48VsLdI-JT? PyLҮeߋ]H1dHr$0,U86q*{J5V1d#nԩBiR_u!< ہ]ڳ]X`*…QupJ DK¿' ozöB/,K5<7HG6L i7$S PqM1eۨ4U 2|"SjI JZJ 9Or4uc3>F=$|lyJ"g?;!]+ xTbolE1LhRԸ#PGpB%U&>wZ5 .DeWPyδCJ3fu Z=6$2fJZ5bH/Fb5| ^oy 5̾( 3ө="q{y2y`]IAJ燰܃Ƀ'9‡*ov3+PXL>*Pj6Px;FL+zwź*8,d-#c T3oƢnN,]@-<@N Rő9AE'x]J"gy^@0˿r5(2GmOC 5E'Ur8L[F] %#RsW,*@aUȹ7_z|VoW* WC,׺ﺉD*MP{Z{7kNf~n?<)g"(ŷN`~`(aO(9o|GtgS󣊟 IFAYir$2Pԁi bEaN P. 6}w#->z2TN(Gd"!^O*}#\ 73]\Jڰ ']ψpy+n^! 'L{O5 3jQS9?ي6-gxpk9 a}ZUsS&b>.YúaLa\Q"B9k6I69RnW;- r+|!Zo!k7HRȫszjՐ{ww,1!Gq;n|o=w!rX@E/6֣&-.utRL)m*]Y?&Cui5ٰ-= ) Ef#L!i.CLg W׺Ⱥ\ʝk B?Y6puQZzGJ8KePclka b0UOgm(} yo_Hf+T;t}3rDl$ RH{nFoOβvtʗٝY@ΙbX: ٜ3]xP)>AÐ݌YaC&yFH}J 8P`p'C<6:(W*DwŜ^4H\h#jb;\U5\ؚظIK"D\U]~A tWU-|:?..$Ok9đzI0,Lr"`ҫ,r,qfZ6 PE1 rsK^ܬ4=iXMC5nbi$饺Ԅv2B}PJQR4T6}޴"?0i q&/[o?9 3E|dh+^-?+̤vMb qq5eR|s͊|,ϫ >m8`Q2UHhxŭcݳ/ leḌhu jͬTt.,#E>7&dy@evXr_.޷G@1Y9(\)ܫ훒N&wYsyaJ4crɱTiUu| `eHt; qaius9Vݚ| ˹0ϾgԾC,=] }).] Id:q;n!kdun .M8(^nkjg^UJtE >?,{BR!( gehz zh'ET-4H!3 :.C9l8؝w_P+\}Dz}U$'qrqlSI)DWn`u~ T?[@,v,jS ]sб nCgl,r$ױ~.VD8@ĬofNGoY}V/"=^܌äVn 0aq Y-e FT~g:OHi`M}p8fݣE}ك,MnʖӘCp#|ȯ$#%N@;l*J^`N/*-&KʱqC9-igx%:ѧJZ$?_dEӚIKg&!0/!^.Wmm`@RXw^!'uebZKgeiqL}<錄frۧ G>}ke{<} wX'i?($V<wK^XezJPrcv\XeK|4`識~C )=[0~V: Xu_Sc`l EFHpTM\!saJo}nLoy=8M@ @E:FɈ>&'0dcemjmm^ 滏rTtHgWPU#1nDr8,˶T۠ZCj8!e\ w[/R~nuF]bRSx*wFƮ˴w*XNS@ڋı__ڼD,QQ!G~/dRc\N@ߌJAGz(PyL?9M<ڒSMaVf~&z@>S?\r ])Z2=fvJYSh.8pTGܣ^*Nz΃tb_s]>$ڌoW+GhR$K%&}IAQĐ='%wí.&J@.Y+ys~+zshJ4م7E*+k8e0S?Ƙ%GKELaR/KʹF+C@gfo\b(iE wH\B 8E+)5>NM֐gػ5fwļӾ:at~ )dy< 0hcXAte:d} ޺=l풱KS  _vi;O!D]>>cfcʔ1*_[.dyt;x-9S `j"ÕRU#yEL0U@2*Qw[Kбi"&̦y-PT >F Cv~.j@;vuO30WQ\Ƚ[[ =79Hgo+8b=i45p*B_x4G Vקah$b!OȁļzʸzEyeXK8QPpum 1INݸP)Q*jw0째=EɅt"$yj׸>h ;9֡+ƩRI`d42U!'mxzyx؊E`^jp4 Νq>ja~ᡋ zO&JNxYZ;LW˷>6-(o)UVvpPm!?B/tVilk!n|!P)%NC `X9#_qBwrQ ᜾G!p{1(" ~ۻzʢmaJyy@$K}_. 0'tCN>h˜<{?ܻ (ZÕ\ce,B25((j,yaWSXK_Iw FwIBJDYODJuiF$v 6g샴Wcq$ES)PyGwxv&u1plh$=i_,$cP)|` ^LA k~!gLQ?Pڨjx/JdpI{~0#64W"̡ĐdhG}nǠvmD:ov8FP`a躣KZYyqgi[lVߩF/ǘv0.11ϯ7[5ʴ5G?CO/=&v>NDb wZ"(%*r_f9ּ%xaĤHSx4}Ҋ9pm6) ߂fxR3%Au Q]UR/*2n/yIr)KtzbTX}:PP̒hpRPa-zu{\8BToc]Wȳ` >:!Y ?y%O7rh‚&e&tԘ4,{2 aP<|KROYr3]q&Z(ZNBPpdc^*+9$a-A@&mPvm&}$-[ZdڰMb=$j<H~+ \"3QH.A[4I5Pj!8>TzNc8 :}aV>YO@|}`m[q5\قtE9wLP^M-tȁ8TAF\wg{. &`ÒЧv*4nsWvaӃ.S)DW:)Љ<}+ּhz&|B m_D.1"5C蚦tY~"Z; ~#R[$DlObDyWhrYZ淋M:GזnÒLȁ< +`cV?h>Qa9$sV:Hv8o7zPht/̽P,*`L"EG@Qr)nPʀ HH{?V@Yp2..Ͷ#SP0`f}I KYhϯIwp1813vi:vɈ)Å!Ox]Wu@J' kQ.`8mv}bd+ @(GfaY-&,hzfUَ m/m2Ut[#_k@B@ͷp ki?3\֧}ša9:7b<%<;5)a~4V(X1G:-O >Fl( ǔxe)~V} "4ŋ~ H1'1Y|fIQ/@w ~eW %o2c13q8Ute>H |+y_HS븛_qSg˼KcN-QjޑLjwFqvn|D)ަx}gPx&?jGrNlof2|>Y1J?T@"P 3L|>~:6`a=[2W3fa(#Ȗ@-_:T H(`X6Pbp@Xzg%㧇7IJO!BO* PTpە&mѝV%T3*(39mURqB }ڕK~\ދ}+FY{X̽4#n'Vv?4´te>i)nj0*rf<(@Eփ.YhF}к߈MZ1B{P^I4vͻʾb)F6G֏*'{>PDzHazf)uBC'._^@;+Gso..V( 9B-gF7KAS_C[q{D6}Č8 C_òTV&`gFH P=zPr͖5c܋VmufHYy]&}J9elO.i=PoeM%vh coϦӶk]_@B'J| Lc0:GZ|DDCcN*P)4"+gֶ)g rsf< !fOQ5 );H;tD ?Qqo £B]%8zm5E4(8ȅBCP7u2NjһջLշ\.D2hB ;Lԇ^$ :B[)Y ¥q䤀xDkIkSMa)cfiOr2&k&rtQU&l $7^X!RN =hײ٥Rl5>',MOCS4EGPQ1jX.7b+wB0g7PTtl%mW2bBF3#VY0KT<f@t4D5fe^Y`͹0PL'1ؠvcFҲNtUQ<]v/ZEtU;d"Mhi:l @7S\$Gk*P|8\u !15u coeOr΄i:# 6S|A0+*: B|+ B?C5)ʎ cr#|5bU\όAof\%:_&SoIA 8S=`. rR6Q!b!#N4cUnJ_@ l*tQ:,Ƀi8R!6\[ 6f22!@wz h0EW`z!lIUkMp,؍]n2zWe&B,cUR$ Ua)0 bL,r@qAv}; *A02d8ps oxd=^.wx<$莫~npJ`1Գ͌k*AKNZ]DqYNr}Gkg{DC2fd ֪R-=[BC9үE ɘ;D:[(-hQ31rޒ |~ěOiQ"i0IemԄK^a eƳksMPK9cOʱaQMkR

X"耷I*_5p i|UʄyxM*5Hdkn%l s4#XD_љ)PSqu]Ol7z}ȦvM&,c(5'J]diG*T!J@a<.qz( bi\eqP|Լ9`' πNRg__3ʚ̟3eE/T]9|a<(Z[ۉ*N'.aK9it]{ʎ"sfvӥRQl5G 19yTofcF-MkζS2M 1mӪm1|S&1e"("'\ tqjKd`tn\T:㏝ S<&a'ߤ ZHݴقO~v X 3"-ΜU.RGk/o/{֓Rk\U) }S٩DSҚsamFA.^n!̈- lx+٫Zʥkxr)5?$MWOz{oaIkuשC:.0VyWeB{Od=Q,3֥9+=U^.k;%oۿ?f]I4N)JBk`u0%Y*^ -΀xaKPbVHaJLUB80x9\eĢv-Б"Z|wdAݮ<=k AeHp o5T8i(Hm5e|zJ o5nit3c.)w7V$Fǧۤ/o$ 8w奎lQk[p+G+6&S4VQEŊ.j^1s_ZPI]4 ߔ8 &rXZ/ǥ}hP< dG2 2p}a*t1C0ra+8gn;3*G'¦OӤҞumE鞍ٌO3] vPŧ󁻤1; ΂22Q=-ʫ,c FL~5W y٧5h.VUga V# )]!EzN̢kG޲;hqbQ2 |eA g~L.xWf<E\ĕL坉3=ppަl1諭88 K2mOM5#z Y( m 8-x40!(4Pf*1g Ҵc/&AixA5!]h:䉭1NVjXTiŅ~@}!OT*6lNP!_ =Ҝ]K?B08]?s8$\I4;mH+2Tzo 4p];J>Z9N7^[%'?gɵŕPrr|}|;H%6ፂ|IDKF]B+? ei?橸KlGԽ?oR d jD;}j\ h&=i tu9),Q]qW(~glc~nf'*Mp=KY3?%4KĖ'ug6J̀㳾nw} ߨw1`?0^fda$(|T1 ztpF㟐G+X>Qȅm=|BR}";݄(]8d`yy!H Lq+ G )dpN\Ûq)NG"<BX`vж\s-V:&;Gsu6p] |@]5#7$rS֑2Bu|gGXeԡ .Ob^3Ic'(#Y+ gyzʻLf(y_q,OEtG~44ܳ(|sXiBlۋ>n Z*@P P7:Co]ҙhfіl^[@kSya 0-щtFpt%-}=yf$aNX$H;Ubu.W$'YJ]y$@hT4K :#d-#peFBVzH–m=m 8c%uk҃o`iVt|-b(@^gN'w4j\@,J-9}F~&RH#hBbgdx!!^ՄengYR@nӸ'2Ґ iczVB s ?p9A$]6ʊ0ӫš##N`Wq^2IޅH] a|K5 Ul쌔"pp׼{?s;]01q.E^6{H1^%-ѫLDw>(ݕ!ZڦJ iiu>U~n ##Fd sXq0ddި;dd*Q r\QVU' 3=<媇l?)_۸W5)$z=)!89g %Sߢ\~%!0AFUMͯsKqɏQ!6ĬF3&N2Q }L-Y,\$UPȡ 쒊) gIm WYͷgnbyѻ>%YhaDʓlba/q&.ؠ'"WTx cleÕ{OOCٮ+\go_/@66Bq9Kb(btx΋I@CD.=E-BBz9U9%~2~?DAF<$Y_ucx+*nmanQ0";S8E*>UXOGgď2IM #[Y7ZȽ4xFWxlY+-)2̍De(>9uZ F`+G^רds@vh>ӌR[ODHșFDIyG"O31΅zYaED7YB2o癓'Ȭ M;\>QutrAo@A&4s⋊lMz%kj1^2||JMop Q`i }ё7̷pr"< 5W-2^*Ds5/Xf\dyP-`iu NjFfl5HC@2\lwُ"Vc-a"u#3Ȭhq!-=A+)1p%UR,7X#_H0ty  ~h)zacUNTc;3c\QLWMU޿mg3"[lcʘ &*,'$k i ,.Ea \ ʋ"/8 `73%W5j{>V` JcYJ-IYN[+rQV[g{5*9̰VOaNls̺- ڗg_.~ y3H5nN*7)NZv'*q^[H)_wi?J ?x?+U7'6D%X'LG_μyߟC֜P "eRr A q.3\qq<^HPMTzhjl/'Ȼ]Nk|j/e"kW&AϘ~ý+buU)"T ;LjVp_]~sI5lZ*b4-#ظ'y>^6EY(r [`uI!~rUAQR0hˠm#uUwr6Q)IUꯏ6 ;ԣ[sٚ#ʨ9܆h 1,:)G!b5d6Oȑ_Ŧ<LЖQvgpjgҪVE NCǙPwvب畅Ҕ>q^ҀG@,&&l2Y`oFk 5>(JctFsKC1(k=crۀǾچf+J ^!wZIRM1&|{ON,Ĩ14<:p֬kѵ}ze2PɸL7c̪â_PWQ/d> }V8ݐ;UXxVo.9XG27to6,^'bzccZ &j&7#odX!:%%Ȱ*iZLњdU&5WV,-єgCڿaߨRZWȸk^$b jܮ@|d!c\Kzt5mklث+l \ hۥOֹLdҶbHLXD̶ !kv= i@vU9J?kpvjJ5 k)@R>8șjc-7KjXPf͒KOQ.~5a应RB4c$Q| 9|-h-wJsogY!:-N>zDrXz*>!0`pe-~DU,HҵRN=^5.ixj?l9eq8 _fЃxJ,uK vF+BU2 VubVoI_\!,۪붻<2<:ՙ:)p#UkhrYΔ\9"Hɔp(D)1mtÎ(4R^!M0H×Gv]UXIM&W譗2cRvS{߫/IvJoU򕽜6,U5Ϟ/#/]*݉@*ڡԊܗA`{dtx4K2IqHiΠ ?nҌA@Hғ8<R6l+JH/%χ ôYrH#+_0&GSq6ց pURPp^:HX6 )GL?,Vo50hNEh I G|hyWtx>0J 9#\[p*҈Cc6t+ q]4V8St,r8d%hA#[ 1ٹvG Nc5`ED!`0pZRM+z&][cTHb.WC нh3.")v` ir 8b3މn^ dhؤYnW0ekCF%x*1Vہ+|C6# r2z_DW 2Omu.-< C8duˀQjq@%@]yLNK`dӽ[DОoE@ 2Moؖ'N> 00er+?Qg(dXcZ,]gdG@?[˺(ɗPT2rּfJk#ޚA._/Fr'pPH*:.&CcoE<7U GI>EbUyU!ߊT5ᙽkaWS.2L^J4x#mYIXUsL7h~ +ڱYF g7k fDTO\p<&SC5ƦDZYW*̿qJNNv1I^/%й?֤CSB d?9|NĔBv(a*zQ&rD'Fj~,ՠ!d"! G}b/ibVHS"P> 4FS,E4])njO{{a")odiė u:Qi0}n4_XGSkxX_ >q;n=3lizfpɭ@6t5Z{\tiٛ}0ZZpDʎh2" zRv'S؟6"l HϝA*b).d O lRS.?6"_Kkiʆ'9#<0% =| AŠCo 0`~P}a9jx7sM_b}iu|4 . %QNX\0'W%e=G&*wE#0#a}<1I x:u7o,TWq3Vї¶I> V 7}Ț!w1ZQ8@ >EhK`=1Cv-rda7r62Us_[ׯYbHeb.0`sx!/6 [϶Y^1HuPpQ{`զ'"?"CRRH3I2^eYYǰn> LDn `׼~F{[՘x'gPĮ>umJd@ӻo~fé]bib`.plq^1֧ J ɗ{46Q I[ࢉT>ne: pt¤f8K7ђ![cu ,`VFL7r^A2yÍE NlsV廑f"{gr󘎕ujxBsFO5E/J}s-[7 |Y+OP*19+DP0?Lš 7bvjǥ{;#oʉ\AK@2cs/dRHk  ;*0l53 oaG:blWE`wNBr(pY@8LbFgFߖךM͙>aFO3]vryO8W.;jE_ކ<@\/OJTA)ɟ)ga$T~I/՞hBFBm^.z Jީk&P]wꥶ9rSrAt[_""vVSpև[e|nhKDeۂ))Bf VDQZJK(Vݍr{@pfX{o \MS98|@IwC|rh7k5kKO߯Gm ^{ OK>娷$UNpo-`n=nHko`߀ȿ5It-,& D3HnoqĈP"82ӻ^xJŞNo>&ONǓٰHrTGVO.YD`#NK(oy/^2 H}Cߘ)[u^1l9WIbÎaXnpeDϐ%2Ngׂ\{&(֥vv:Khu͇VX> c>}jJysU$CwbP6EMrƁʊ{o SѕOT_%ש6-څ8J⽓gmhC{/؊`x2ȄtF_UߺI`cxnaw+Mw;'dà뿤MKn8d՚6n*~"CT <$tˆ52r1̨2t/Ю9xQq9=!( Ӱ=[h0s ,j/(/_xrPVHU%-/A$iۙ3,Ĭ&; `p' i6 GP7|w+yw,`fXc(]Q*)6]a+U_I z5`صAas / ,O?+-ޚ)]JJ+ ݓIyAΖz>1)ZʺOP;_^27֞i6mw v E#*`[5 IRft8k2} l7v{XkbGBڧ6r5!i#{`mp?Ʊ./`z'8ߢWF+ j^Lb@~~c\uH mv]) Z/\.P(0AB\>awN^%pMf,k*u!C^! R Gy&8giri6Ք \US_8q< $ y,^TLBPae:sA @:nSrVrC6 L}m HKsZiՙ*OϑփX7?aŔ OV*4AKm|棧Η(_KL2gEgi4>@yǠ6-"|j0og4@}ɾh6 ;p>eȪ~G ge)<0Rtx,^TsS~dWdfUT EWh2jJ4`džf+{;"Sޖq: )G9 u8uO9љv/9YI_1?BJXQYOKm8~p8!z*rwcx4= ~w+ ;p xlf8ɊEXX)coxvyFFJq%vU3LnaFEUcZcYof:4QABRgO%]KNDZ߅J(/8^*[KK3"uFYL X )OY&eS 5tnJbY|ά_0`|j*N$;RaY ͯJf[90]3. M$1Xrѥ3Kd+~ե ڙɹ#'Dy+=f_AQ"(gF!kU R %Wbxޏ« M{ħz7uأd*X=<ޢ˥4""bNιYj3P 2˞7q(}-`cϫ!_gÎ?526u~:W7FVRYHJW؅ݒ\Ik%U? 7{D ʾR1յn:B@ E3Qãa.yĸVLbex@zH _Y M,HSv BU &]sm1UKcG?WGNbC3ؔ/JGbd\m0A#7Ӎu HG8ӓ =O'ʤTRȂ<0q#E#!_XY4>|ڹ& doIb“ j޳n2J@x^Z> Ӵg\DѠa(uxFr8!7ë?s9s[|+L#&.D E W2;M tL^.j2pgEӺ@Y/7Yj%F?)"ȒTΈoS/^N_b^ST/ac&7]@1|a^}WYgƪ m!Ecx2,d gE0H0oi1js: OV9cMCr,B̔n]2t2Ty/>)jl*ĝr}~MHߊSV`TYG4\3(EnZ0P$P&js0d'@=n:]@OY~&h}|w9 [h %Aچ3߂yfԗ~Gҽz\}J}ĐE>@~Yt8| wE8iC3@n ZU,knnp)5^eR{ףI؍]u&4(i\Db0D2J"w\y?./:AZsY0>BPQȄ|KJ@~d+fÓ鏨װZLFq'[yܐˍڌD /=n*[yP ZbSY,4"n;-L2acׅbwu" D]682{"y+[{",$PxE8h^p֨_ ,MBD1jB|CE5ZF'Hß.s툱B19x"uC`G[?j|QWw1#&BpzX;\[lx!x!܍z%Ka-s|k81hAQ JcJe>A AD BLړ4\F6:}Ѓv|W2i4#}éQ@S .+g' -"?M_j <-F9w1rqZJ-@C$ (*_1ݛ\)S6[Yً !x17 e+12AYT0 C*s|1:zIQb0qXK#ΫA:'"e90!jOpwVm[q1ԓVuJuП0UٵT5 ]Bٚ+5Ua,uJ mJJ M5Ԋ=[$3VxA*H>&*ar;t <1gWO^ ^;jHQĪ>҆0jJS6œ ڱ3ۨly[l\RT=QG [c /'yXNV\TV SapH܏vN87/b eh#*xJwK鼪,R[VjpcTD7@ IUaV;M>#vl~ĸ;<%Ս*Xȟil簔xf3.v )N1WqE;ШA;Kj6l |A uTAmL|G;uyUگyg5h2nX>?{#kcSV@H1U瀤e*XYd2N`-,i$湹Boh89qW/ٚ L74bGoHxCV5Rޫ=TmIk<=H^$ L$>N74GF4kWş{lfHiU-D$_y1fvYZ'">bTס*P-i8OETo =0C5& >rbIkP "8Sh !j6)JK5K;ReIEq(DԽu[/&B y {I+x~kq.&NԐ/FqFiwޏcbĉH'sB 6tȋ~%3JW%m+> x'-=kZEU7IAJpad.߉*('|*NdAWcVV́sV@<=^\?~n4|m** 2.|%Ewk{ptfd<_bj֧ˇt[g`I5/{#:nTfh) l,qӫQ?Oں'Y9V`PQX\Z\| 1s6WEu|]H}&w e{MϹˎ닂=k#SVH#2{V Sk$*@{$[%-fX! yD+W-NkK[IpgO2o`b1Y:|!`8yUDh5 0`xy)p1IۈO-x<=㰻GD#JR`Ԭ~=ʠBU!*fTGdjC;F>eF&M2R-#O74isC)XV+z^٩G& ?Y4eh8Y҉Y4P,?ngZ(]xtZ*IHry!~˵%D0׾!&>ݛ~ͳo@40_d|ﬥ?|Lz}Vir^-r(8k4`xcՌ|uF`ˉsRON-;^y<38+m4nx.:|iW^ņUܦ4N:1^B䛎\NR0M-+%+uhNn~>E&LcItA]0(D|$/W5|K1PA=v;YM[Ll,&<Z&"drPzr-bOSbzKT~W4$)_j8[3b ~!'\'opq>iaZGcwqV.Jwţ0.CLf(mx"cd|RnL2@ݒv+d:Pm8$h/Srр~ic!Zŕ~7 8ގC%GͫXq{T?W^&NJCO.Tfֱ[7N|qBOcDDMD/W6lIA˂WSx-5{I =o?(mEHqDq=~\Lvڧ sCnQ ;ف7O u;ߩnGs*Ӵ8M|Cۦ\BE cLJyLhg.VNzH8[gdh >;旗8HC*|"_:"lSg0'TP#jrm<5ͅI鵀f@BPxb*Q &c/O;9w[1! _4M1m j>U/>`&}qj\Pr9dKM'hJz1r\ݣVߵ'µ(U6}FuM ȒaR:TE0Cew ˅@?j;ϓGeP5F*GP`}l#N5\Ȳe,H$ަ"7Odo#2&7C;mAª1nrBu ։J0Hr@eQP5N쁬ԍUu( *-uFW@u7_ [f"-h^y|7s;/ݺ!I^KTِu\?_#OV :KwA @IRhk*\\Q$ʥg~mpqH'UpJ&4~j2|*2kݙZ $OE@kk<~ם|iOQ D,` &R˽^ _qcda>t[(gj&v_0P2i:‰V_j"-[?S[3=b`s̍J XA9H+YT w lF2RJ%T;Gj1\: 5;0;ĢH:Wq3!܀gy[/`1xPv+^ h8;Waoa"#i5\("`)1ˆL!;'=&f-,S)LȺEh<5ʞ@o  u90=u_ٲS/6ӵbIWE/&x0lRw "X#u,(\!a1@8*AʴaIauJxl;tDSh0*1<>1qᴶ9'{bYw/\ Ɯ[h75r SQFηBHoqe1Vg}NbHۖ011{K0#sǎԞUf(jY6T=v`䛁@M +]x.\΅PM8{yorURQ(LTȮ)sz-PqNCB$AL bgJ<-ids )‰j2CkӇe+-U"Ju3#}hN9Ջ~zI ׄ,XQJmxk,D.5rhC]Nq]>>b7MP{b}!T5L/;mܐ&U3¬E1'=Zgպo2O;g\y'r_I ۗ(ρH0I ۍ(OJDYI} _M:kkw;) f(6UOVN"]k~n+sa6U}[>O Zs/mƉR5U-ʭ o!Q&5=?eۈW&//ie)ߌO> b4p)!e;fݸgJMMtN{{{=K& VtYF0FاiF*6|3L?Y]Vv֣Y;1]yْ Fޅ&%nhc(s+oP14|Sc

^6D-6@ͺ;[zPijCmz6QM ?Ng#L&h7ZkB/ص8s5ө | K;y ,1OŀU)fK3Y(I.4b8fe䂾j ]b =n#p\w1 I[eoK#<GP4W$g4B 558g kYBӁOzѸ٪;,%QQj|k`BȨ]Pfo=xcvt9؎k?D )C]UBS;+U1 g_vқ1t~ T'lrC ^UY b!=ofsgZg椅k^QN92N{`%MkLd>NHDzSؼV{ Q\j72iЮ,GB0B4 b ;ӱ  MPm /ZT6#]j hJ}ίdBE.[[x[LG#c3-8DKy?}"B.+|  }78?F1sXωDucP!(v:67l]&a>܎"urcW7P#=@ЉATx.a`L*894GL'KF9ֹ Mi;[d]X#&jpnk&}cy QTFAwD]~Uv8{P;`{1pJe$۝$Piߑy M sq" L7a4Ŷr<&Ef"<4 +R9h:rpxOQJ1KvcgLJ;fW5i]Eߒu7y|0 E@b1nIw:'pyPMd1ƃ/);,B*в3ryn%~V]cJ2˧И .2̤Bަ+5y|[;V zUVŀbʧ+LW[6'nǵbk2Ni$&kM%S*bei?Uv =kjQ]-uO!VQe ِ>M4' "wu t!@g /(3$xKls w/HrKC>jg"ޖuC$ w6|A F!]bq:e(cV軩ȘV o$'Jr$r*/(,#OcydPuth>1Z;A\Z2cpzLs[b|2ABX\&wF'Cw_rK&J@FWA)I N#U"_%A.5fɞ.8} 0hݳA^V%-?(իS{Yض۱H)2ݦ}VXJY?phYNPr:CPC6,[1G;<L}--U݅'y'v*Kzl !65$(bk ad3iAnWB6:6^>k-}.3 DWtzn d` Ҏ[1Ǎ4h6M;lS!8sk'릥Q<;-Pf]1FHenѳ#,ᄠQ1fq{I9xlQگJ h.S;\|شS%0y qmmy -5h[ 3΃"kSwձɣ"|lN tȩO$؂c6*g?ؔ%˷*oY 쩛f,LXSJj=K̲uIw$vlum1N Yֳ&#`+yFшJB9߯*#y7v?36^xG/_=*O%4jDCbb,8mFzv\ڕϾ6cQh@O s,B$MSxLp`U9o<J+5w}1 ʕፁ>7P7{hAҩ3vl,xӇD;ւ%fųebRi0qdc}W[)6jr&䞦?jrJ!?Vo{A(8 f7WA v.R 2PH~qp:iÞ{AٍO"}n=A]qPbv%ʡA5=c)"6'&K1oɮ"J@ɇ7b΍ӉoM[mpvxDH;`Ҥ`pGeQdkxa+Iŕ4%|1 Ϥo$pПXd&Gg/(RgԜ36\gHA7Z>)K5*|ɺ5'B`)Dز&5R?5_xS 6)t/^?-*ҭ LmURL&yhOHiJ/W L T,bLxnB%BP  /W&LLͻIFȇoǑS9-WM ͮ6D֥-p?cHe3vd heccUQٜ1;Ú=YII_m*gߙD(^_-4o!\' D3(#yp&Mbȸ0ht`/o@.vQx tǾv;sbUm!GhJ~Ȟf~}6rR`> G2!Y`1`s!S:fP|ae^ C-<=ND5 5󙺁B|{ 7 m%j `:M+d!Jաѫ֜C4J;gYXם}^z]dW a-D`P@hVIP+naBSK?יo W\,݁o&ɨ/*:MUn`KCNqa{H0%'{лH=[jރ~0 jyHI!VQz.2W=N 2(m]bc~'/Ho^Mȷ '\d'^>=悪1j3)ƛ[+k]yxEQkMu"O,ȽIUO lh>;-8ZnVafu~+Quƾ{ J#N;F]05O׆F#;Z MטnFk:v.k`)Y2@_IBoHT7.FΖBs7Sg*M6m@}o0a6_hT$| !'ޗ_NcoXS-z1Sp6j^3'u"fu+D0&/WrQl̓<A0h)gvLb7oBZ}*HOR$nt)2|Zs:8LG0_~hI PEi<)}׭ѽ x-o-=^[ NͱKАM{߆7Jr$w?"{ǽ -S`ICN3lYcw|u%%PsuAp9<)0͚_o$nͯ3 :A0w .hJ7`DMc}j6e0iS`C@1ߘ'^%[,`&q(筰6Y5y&)qNTXت9<,m P(^9*ÿ:Ni'?c3C!ZU:Zek\Ò5hH%xMdž&'bm'}8m:]!sDb:n R.K}4!IлBQ*{b H J$ *UV?z6{{@aK/] küy{ɽbPLl5(`?jęQ9y=.ever&1oq=~NChx[O~U,} :|1]t|ҵF y|*\vEej>mDx|{R1Y4}s|Q edHIgZoP͇*\%Cx t?u9(5]t(UwB5i990ݨѱ#sajAcڛPOidޞm]\Me1+5Z2_ 'Hw&r+Mʚ͚:`lR I3Y`̌GAu:lc|FZq\9fX{'rg9cBTLaϚy 3&rETD\d[/w5JJwC}ݳ :AE'ym{&~RrdTxʲJKJJEM5+q%M%"ٖ!$}Էxbl:]E9ֱyE}\vwbؤ&aIb\,!IfBH S]|S<nDKH"2EmQ F bv>k7x!sg 2a.TЁppAt}4!ZL.R^(}3dDc&6NB@^~ېhŨ]=m>\4p^=kjbTyaJ(?vhN?,WHZ{ CVA69v_VG*F9Wa4v0Qg  JZyp*9>z]sq7-r gGagʫK, `̠cRJ6dmVX37d36#3YU[е_0_$p5EhH3AE) eֽҦ"*_ 8m'$J&`lj\KC\RPԛr ;B1l۪ɺ6;۸ԯTz%Cp1a46b># !bR"0r1ׂ[skk:_m`6! y@n1 XF?T`ޯ@]6[#f19wV_RawPI$g$Ѐ8yJ* `Fvẗ&JIieWyI: UsƋA/x&2_1kgFH}N: (c9bqMh˳q<W[5M8ntbb;0h&ҧKF*§d^OHF3u>Ĩz|4a69&e9 r㩖vq( W`'7S`c;*QcF\͛KV)=  9wɆ 16a'-_@ $|ǣ$:[J D|rDzx`IUa]a@7!A'Jzme-wOp=pPŶw$ts6#cޤ\mJO:_gp֑ D-] ΨO,ZmguC.t3;W{KQp v'g.@|#>0bZ2GyĢU3Q7"'(OxVZq\RC Àn=~zɔa8IJ.Y2"8j)T2Mx5*beOn19W!CK+sfg$ $nv:u>)cn*z" e"^S^y3𦤚=i@#֒JijT8XEs$[ފ};\tާ=n~9D: ¢9-yVʯO]{$$-gG* n# s {^&AVPYU~y"4B UxY?YeP(t" ,{ՍfiR5̱fS OjNXm7};̒7Sj곒A`Wxz %H ns?@?p`4b[2?688Ze1KI#JqCr}qOX@vI? #{4(!z&[NJEe[*;~ |?rG(p13$ 8^PwG_n[w8mʯ l$.=15|{vݕ06,*ٓ9gCO6$# t!3H+K!IOk¬ǬZ+Nzs ajz ?]щ_[:EovWy(eHr=[EP䑻GEm޻sfN4u6G`_HU -5iښҰI|?!Io5Ż*[su(- '`S-*+pEߎ ֐"Sa4j&N1>$Ct˞4:>sWdth|F{@IuzX f%QMfq f1gũ|̜;`?͈KoR]d?{u>F#- 9Ri:0yȀe]9"vv¡yq0OS^##غЅ`h=̔+=}*K bY240 (ium'&0rhgBmE}֥V@_5<|P+?&"HSIڑ6XGn($q EV5aB讐ZIsƅđ7-m.NJף1߽_nDs$/.Y=imVStL5)%8@Ev3uM: k1t^2n7 {|9WoNoA6tJʎ1:+KJ-jB#y{bf.d2qd 3\rC#ܦlzfңCEMrIfO'ee!6s0OL) -'ϬQ)^lXM}}Sv;8$[/>S@0G񯗢؉4]QUfy;+<[E кt-8Aʸ C8}&X$2* F;?B4lTT;c~IW*iir$uFM+~4o߱V[H{2%C ە9k| ~m#σX渆f5E19:j)7|"\tze>nm)dDϙTn%S^$,P_,*KHp= rv 9! )Ipg/]Ο N i"S;xfM:R[A%fWf¶#3dWE [? X>sD2D1nŒ6V)Q1&s7:9`(!84G`CZ9dR2JFRNּMH;#QSR2A?qLNvO/aYؾnHU?_=d67#̶#k/ߝxӄ7Ddd2-t`УSRXrl$V_cHaZ9G:~0On7NAR%.'\ߩחu{w$ 2$D 4e7+ wіV.-!I7yL P8e+PA\Qq$a҅wFOH  G4Q&x*P\߬jv:*_II gc7Yuw!|jiFz3O1]Ѷ B<]a?>E g*X|!В8ít(ZP}+@KTYj%+|gEh鵫byEFq!aFBcO0L$'s`R)BE3_/@O)fd3RX WM ^R>4)EnZy)H>ͯq%93ٸ‡TN}`U$ oppN WmX6#aR' dS k*b2 ĠIÁ(Wn)ZiШRҙ mh2 }w?vs0QdP[i]lv,TB2vS5 ,T^0wHǗByE޳;͹}[eYM,beD H1Pu J,gocxmHVbJ A:B 8 \{:}i-9Y>zٵcٸA>ϼ⤇tMR4(?6.Iq_>G+٭lZ{w2iMSVG_u5uHQp$k>s6IB;E\ fR!iR1K&ֱ>*hitbd%ICW|> c5o,`]a(D7o4^]4BXCvS"/g̑ȻjNj*qRTD٥vwdJ5d<W^RhѐhqC"i#,*a1mw8ϓV(c W׊ Ӵ[EPVgOݩ]ExC~۸^/_ٷ.N\ ځ`Iaj+t glq =; jBd,R,~gZQ'1}M?*etb(g/:8BNW6Uא'}q(@ZfCxY*֍l-9PV͋܇ w(Xk*py=OP_==<,M'9)tƒң\봣It R-`1s.\|R ^ּ$Z+ġk Jeabukr;@04=q-[4>/~Zq0bpn~eEK P=ʧWkEmQL_3%%9#Sp):W\ *`8VqKk<;L<"L wr6c RcP58'Wm!i}MWCwx,{.2i^iVu.${Se {(B1!ma "d;[Ղ`_9ږ$~oR V'jLIB-GDZJ*d#lO2vsVK^ u@ZUcCs1DooJ>"& a6 (Kp{ )mZ&3q3 U x\Ʈ$ǀڙh&Dyh 7u4[xxa ۝M=AUilH:&S_׮t^{!zitUZu8E=y[2.} yQh637 &j,'6hP65gDw/ѭpBtZ[̹,tMgZݴ z'*q;UKLSY  -!oӚ՚5As=N^!Cw;|q5;=q}ǝ(0|:ll dBm5克Ŭ(htp'e=*;@õOX; z۪NmG>\FuT5Mk+-;wR}JlX-D wG1_M,ynR( ke+W@ w[r_n ~ (u6H6G{7Ϣ*|9]2Tq{/Sxu' }V&8F!rk'O ]\a+v ORR ʓmj o'(_j2]GŝtKBi/2"RmW*jm/| Ʉ FkȜSI52HQ΍&'$s풕}!2IIKI_Bt1_ӈ<ä6*gޢr6^V95\E;ڱIa?X).-@OƋp6MzҫF%'SxZnHtbvfR}jEKY'TiHcoWi#7Kn $/]G=Z1޹g3I$3;ؑ$f:w$^ܦjV9=x47y)>9'!z:w%7.nɾW"(ǭ;}'I0TWrE6 L9u\q[6M0f0v Rg/Μx Bl2vi|xa_QeQHМmLQ{x*9S<`f"6Ú/&vMTVP@U4 l?)ElPUYX 9b-P^\w|wSzQs4Fq[kKGڄA,Ĉ a 6zgwd -Z"\g_#Wi;hBِ-6[Օ#yQ2Zh7 rp(^5ekpFs{9D P' !_3 +>{2_ߐvt&%` 9Bi:t5- AzX`#`3F#‹GQC&yP ' * ~i ĸaHŭ%[[ѻӝ#*t'G 7a Xg뱔{~j%/|\E c#nDPo]q.49U`]+i?7r:I _dw#2BцS|rusi; -J cX'u_1UVqMy,2mArjBY3~XiVjI0ROIPΫ !7*ҶuA@l{ܻ~k uwtbٶ>h1SC4.MfKVk4ciWR89R dЏ(l*nε^@'c`Έ:Ίh"hw[vl#jؼpO:&5O5 {*73Mo=C#j` e,|$;#HI{ و:*0wυC@N9ת3zgSbDǴTYϫ}xYO^:v-bБvxg'yCL₶fdz!c(-W_ ʨk綢h*Q5XdrK^dU V着4`t1Ǻ}({M#{?/ Ofx>h YJY{!J56,6fsֶMc<^?e2K*2TEVq=2Z KK~i)x[aԐ_HˈUn ~`фO?ujC6&lM}lL W?o!Pxh [ v02B_iC[(0%K=){"0› 'S[-4 夿MCdh/xY%6oS IXu&qޗq԰H?AZ Cq]=ą#,?!5]ҭf2WfSP%dON3 ]RpLTJe`i(x!\k_~>Ndu; |Jjۃz~bĥ$)>i,Qw3[ B yp XB  $PMCY3; te?*rH0%륄:0[23g8h[W\{-j`}%3'b'PfnCу@h13n)+ji^ VuN[~9fM.-ovD8S">/ՎsJdtUZ3%( $?SpofnL, ] UVߒΚtL;CP˒J "XU" IcQ4KJ7 ~,.V#aD)H覰ohA:>z7l3$Pa$G!vU,e.q@knITq2%BF7e`$4Ūw~/lykRw+*$mSo/WHϔ%Eh /PpUA؍ﳽBK =/ѕI`ǡCxM>qw,mZ$ke,~w)#.Y?T8S}fC>p.97Q t%]Bc#f!S/w'zpli}߱Kۮ@ҞwMy C{vWR52;X3:“8rV^+GY"K妈Q߁s(܂tQ+=&\^;ۜ⓲/l m!P`%i?_gZ,,z0z>ap q:c ĉQQUdq s='!eΟ f'D<a4Xf%[ՠXdT% T>L]߭ti΋%s?P[ҘRQ{AZ?Ȇܶ=ݭFZ=(oc[+^?Lw #6jS9{zEua4t`9z0\w2wxhcX4K7J|x#7{Ś H BPp6ȥ!栯WG< y,s%z9 *qrG Xi|HKqcLZ'aߟ1PQF{m%toѴoq8Q&}e$숱Jw`Xs" Z+^lRA4Et5|VroUU7?F C N*vޤwq(\#}GX&j aVЕ}UɃ}@'Ҿ`<%8LUMjʪt4A?MFl=]xmi {ݼlUbuƝUt_2 (\\' iynֶ|/Y~wdKx̑Aky##i)%K]u>`!U0aP'e- NVr.ǚ}ûW,e5ŚZ`z, p>h(α (XLu.}O(/~e_Cȑ9"?'ļ ɰ -އ'r¡Zh4뇼)eDur]ۇPVƠ$,i8{:_cv5 9E,V!}qm풰~Ac@\:x<4)C̢Ce5٩ɣזi^ Q6(tNu{5ؗ3^OcFH i܈QӇCj"Y|#MTP|H̀VKp(gc"?+L6Z-mPo$zEzkmEw sOL3cT[!5dNr%[y"]QGMRIKΞ`t @{ ҭ'!9UeH29f-SYڅul $PrGqLK~>@~0s\JiGjͮM$ET:h"z=pK g\)+;l[ȓ-CX 2;iʽE7-JU+4NGTvcPD8fE'nGm)1F"|d?Sv7P'Ž<e0ZU:ݲ{| }%a @F濠P\w٩Qopȫ>fD:)zAr@ k9<7JOebkU~F܀QbϔtH{_*yPd0 Y%> ===y%`ԙuʴs^:KҩEn rzpKuGڋfΤչ2$KwTmu9"=S/qiD@ x! (EJh;$89s0-;&ےw"e|kZ5v]ʀV1lXeP3{S2,/؍stp{TRCpmY8e+@!V'q*tZ [<ا!JģSw"&v"1呁YeКNNCa^3$WޡqeRi"熑yA9$TV B@KDnMʟl(PKps o"O/yk@Pm@j3S.dn G~FtI:(uҼYP U?wVaf0B?BId"wUf[ヿ%IkEqشߥT|GբT!]cPʒ%״1ÁY2Q?.H 35=fR@L!Z0 qc)mZ8:_ "Q4UϻPNgic(X`u Ql"W'9x9{$=қ>:{W x* ~?d-X&.9fR4| p5Sk/?>$Let8/bUŪDںΖ362[gBA;i$P {C'f/YÝ0L^W_P8yKDF_+k 5qTy=l\C"y/~KߜLdW#p%փBShouV"[7Н'ՂNa0(E`v\?Ӛp#O%p P7qtFjC&A{d\$ըeO "&ѡŐK7%-+uE,pT< r@Ü3W2:||_W8/.PƄ-&xEgv[n/lvgCJb[}ơ#1;.JyB+OZ}dH(34oOh΁O6a(}nmWJ_* letm=]KsMZ]E_z‹a/đ/m<&%er[ M9sƂ} JHH&]3Im*qQsE>'wF r 6ySyw]:%ʼn׳dBo̓nGjY7)?wH}LR/8ክq>UBXλsFq:5X'PRhr4OqB&FElTaEPpS/B4?/O_.N-+M@50N;iarmM=%j0[WԋQjV1[\1li7JKg|edl2[ tq/vw?5ENs2>~ 0 EgHg9m1L;́Ĕ|\Ͳ@T.3m|1o~WH=ł*͝42YM.]Hnwn*`MWpR"QpA/K=!|)bɄA{Ec:d­>ML:fE l(2F:uq$ZfǕTu>eɱ[I =Ieg/5hQfchQoHwњ)yN( <@;""ñ q)vvqO3|cNْ*q}8PA1и5ac9xtB6 tD V^tOwQKH: 0L YE;7R<0,>L,?ep4))Sk;چ xDIH7Vt!3l.L ݣ}&Dbۥ;ۢ!~lz_y>6~]V-p!_{tVAͬ\rtÔ?ݡu!-e~ꖰQEn7b24FE :\9@+TG+w9 X|I} ̟E´:#hs&69 Gnֵr2ϰ J/kIMAZPzQ)0[)Re4U3Tcv6}JlX>r#qMk~gޗx Kqï}ar%OVT}Aq{d\QwF'?cJs$v:;r@Փ sycT@?wVhį7vs ՓH?ϕakas2xchGPoj8F7 E=DL7mPafE#ܻyYj6ڞ|_.d g y  qn tGbؚ) 9 ?Q Iuay܃N#2)qgiql1ptAFq^i#rW4g$_U)~. āGxiR - _  :oȠ+PwʮO އTSQRF n/7f8.lMu+C,OItj7;h|0vkx};RBb H}B]7\L*{?sb_GnKȭ(ZS9NKeԇ`|[{>@ЈD2%.<i9eeHw(QA +2zuܱ0QM<tn[g|NGphuxYM`P+Ӵtk{=A*ʿpB7/2$ [_ˈ 'VIX RN5o:ӉP![Dz٭5tkv:,$z/xPݪl&(ZRzZ/<:d,d j }@g1a0^HO|lAQ pG+2Xn#r裤^|î'{dz?( TYT ;9C/Ifz׵6F< Rk9* 1'; ?ĞzwBh#B8`F[gqxgJJlWC~;:{Q͜٩:\$c>g\v1VOPHHw6QCԵ+O ITQ2|A:FȞu4Ki#Mc[Ш/<|I(S1Wσc{a"@ +[Fԍ@|)gA&:_!!ܦ@s2E| s8¼nj;ly\814p4I*X%b 1xs αWQ|Oު{wr37x/ΠTd 棼xO'wgqfH lͫG fw0E@?t&1$\^E8.E9ic%Z 1]ܗnnnqņ7m/аH^fO[LiXcb&}{?xT<"\!i-H_T^4(q}ܝо?I]yx [h * :[y]ch6JxuDIo _ ݁Z׳324R I.QX(- fфvBT@|9aA 4۴%K2pCQH'7UH#%_r"~WFZ[K#$r]EŸw0@DКuPiWoӌD f$#Vhꬔ?QPKF~@U9tM{ťT /2ohi^lH"fѴX“-5qKV fjs XZmI23O;1^׭?r󄦖4$Rer.g'c[\ [8q/p?>XuxfeO< 7?wy>7.Y2U'E[5jk,VJ t5ۯ~(.!Gi/c-.=8I*=&`J7e4A9_(䞱jqw؉s&|O x\N܇7ZWc$2_Ub)h: q-TWQw~HI\bl ҭ2#Յ򠂙X t^9[Cz=+>&AH=wA+o${O.E"eћ(#lgi6a1|{g,hbG!Dq%Aσ~r ,BnH$L iKzУ>/ª',;rQ+D>̐ĥ3gu*v E=TFk94*鶵¸5~=f\dn_kF~{u,=¡4oLm,!kI]_&F$FD=2~`!;/{yi!IgKl= 5vs}G>-~(7ĵt]5#\%hg0ɿ(`z(9~I-+.qmȎYv^w.eNPUikUk#2AVPV |3 ͼ @M!vxHb`&++f?*htɿࡈOr͑欔;^L6Hx@P;͏~NME'fCkR}Ÿ}#8X.0K\xK%VeizV}`ET7' ~Xz8ǝ034 D*@ \:livtenw3nlExU1Z&) {&9m88v9)rDro\\1;9G.cɜ9;;! 0]( ?W3Pɜ(IAqc+VJp}PQ$Z6 DD8fC'A7 ~lGc&_s,=. S,HBB8q׽ -Ai lC#L<饶s dh$UgQCEL9M5/Hrt}8B1%5s->NhQUhKFVC'ծfC;5ڽQ~V0sdHPEC=FRo?X )w wb[i0$\$J]>)aM[6pطUGY* Jpv쾃d;Tw85. GVgyq &0тh&L,Kl s$9o;ΔVx| _r%<v(/͂W:8>(5^@>#?2՝f<3UT{Jj|JaĹ%)n<h*lxL.WΒdTlBι[7_i6W*2!U_,Og9X[A] -w!ȁv_(pڒ\I rs81c)7h~ߦCMpI,3I;ay]!y)y"m1BsƴR276(cq柑e& 9V^hMkP8yfuYn$a?.}I:٫קNxR,2V?33#-t#no˷ =![َfhN|ܿ'?а r•D$ pU pByϚ0Jēw {{St?[3/A+ S/.nDsB}e_`7nx4t{oJ|jgOig`oXz@a?1L>|d, "O!tO{2'^CօQk#zXzrzt||L|jnӏ=^S>clB_MZ}sA_xLWxX󋾀_:݅yM\k9q#%R iE3M(3))L_h_orF0wXJA ]A:<2]P5an v,b{, 0 šCׯuu/=]{VSg]`*/s%D6cb*@)Q69IGP9NĪ P74#^d]w:$ SH'\-E.="s7ܥDYx' 잊KQ(ir[0m"%`䋏Ӑ8LE{v @*~U`25K.*TջEŖ5]šJJOvpe~'FJ%6QPlqiV%P,&l@5uI-zkpA3N_wYYlhj_ac]gS^hݸMzCM#i/E;.]7PGѨ~"ԭj9~j:RBة:n\pR`R\ <2\$ ,2(!l}iA^ ۈFxqA _#ET79KhV$h ou 4 J92ASe ,oj )*!4GP㊣Tc36変^(f,m27͋][8B"5 U./_il>f[@Jy-LTqZGܼ:-i3#Ժ,ˠT/TpdYF9[і] 3Ì\Mhc~Jr2ݝT^Rג}ClX%;,9n`' QC99e }m@{¶,3e|tcxfΆqЌ3YxP;69ElNˠs:SQQӣ )qS>XN|{zؑS`-36+bso (2'EN+ԗ7rY@S QV+39ʌ;`f$uHe.팳-@y@: FxhhqaU7zx%mdJ$T؎dHg \%7곟Sc?Ċ=w&Pe2y O\ZGԔ9'\_|x٣gȸ?> cKzਲAAfʢmnGmMÎY1WA'6i~%5u2n &B~.OρܻAM$2ގ,";|عE6T0I#Eڿ庛n iH+Ue#e]ZB mF oOgdRV >x#S 7!F|h{Z%

ۮ`*<p'?{_&Ы MŢTh;~OX2Kg9ݵw>41װe&]F_tH :|W{Rۊe!2ryTWg"?2ڝ 3FKH3դ5 n|; y=<0[ÙnHNu{7sFF ϳPrqtLz]QF_oYu,[2̕Z ,Z)GDzځ˥piR"?7FT bw8i/TAZ$8s$Zį& ĥUYA)Ϛ@ʼS&oݙk3:;Yg侳,왐/A`d[c5 ʼnD|S)#O66i~@N3#m4O8r@X"\k#`kCV9 ^9V8p/5 [qMn4jʂb揙]*Zf>} 1a`bЇwã "-cͥ}5"$(H#Pt6?"M# =݇1&nb OxY~+Mf\\p@Xc>tekSy3J*QP ade}f-diGGFPp۹Qz>p݅mȪ3,Ӻc$']<7n:KVc45J`}F"XSvj{p]^YYɜ-ppM"6Ӑ)x⼨y&qVOw03Q5lzi9FdH /q_6|{93.%&3 3cz\h U?vBA~V҇b6+vl'咖M9G?>b$mzV3I7\hETA#8TYBx1]8seUVb@~* :юfѬѐs3 J( @1~2qV>{66h)Cdf8"O"BJg%#*ڊwORXn0nHgXa+JSQ4h?i!CoTz({Q Cs6N~@i\~҅Eԓ YwkɊ\*fT> Q8d gs*^gQIrm'ʢZn"!0 ,,ꤕЕ !U悀gTgFC6QG J楰hxv EVg<NN&ks-7GhJvqk DDRFwv=Xf@)A#R;d'"nKkB/pSPfI\-*gyFbޏaNiç?MpՊ]/|fpY`e''4|uvd ,/v+@ȷ6]SMJVޚ 9]Dy[(f`HM%5h p!P#@|"$`6Ve)J)*hE?i~Y K֗ZqWkR2Ћ' &vWj^zo%%_BF._WePWX(S7{JW|K7w!B@5k"P5O} b8Ś:.am3m~Q_'GE oT̃lm?Zf0Www{25y2#rLس,{ ۚ]NCgRntj vkֈbq MO7) 7ah=#Y#Iu> *]dw:rokx:ꝛߋ$]yrM(3f1R3D irfo` r6} x⌿h0~︐:fbOm=`vBt!|g(q~ɗo(g1~V}n; cO -JA8 $y!7^DW u'S x;g^g(TҸ?,--i"9S^0XT6aA1_Nm_'pf~}s~4WЧz6`G?:qSBt5";C%n)zgʱb9MlBnvBZK 8a㋇Rv#t?.ȍOnļYYMxfj;"` w@omPϑҚ}nV\Ki:߭l`lz{I~ }[LjέD'#&F8+4&Q`S-(}jAC820z >2bӠQVZ7+*K K $%Lch JC`@OC{MA;{g˖/Wm44 [JȍΌS~x4~wpͮ+U@ƛz}U_BY֦qFz☙ d m`7p;Pn.lqȴ'A>bS8?P`¡8κ@K3Bt=ǭofg+IsJ/~B="bXxGC (̨/4FHwS!}Vyؗl=˨>.0` r_w4׽WvRQc*mLko1,#f<:uFi %7EcGȞz(;[|;nQ1&5ʬLt5j/BX߶x ">)|N'd^W|{>!V%* bNA|5 K=)܎YWr(ٛ5s9n&4:ӣ҃n #{MϾk9g:=X&,Nls׬:Nq4 VcP?ݕ+\ݺquҰo8J k6#؜nx<PМpaU*h4D`ļKbΑ80WJ9$ĸ6<6iAg\zqr{+P2fea`OHqI+5xo߀(7:9Q)%1;L<`mɞ,u@Ƴ-LY$IJ(N#)U9GUA$©Fz77 Ydb^x-dï:JW 7{d~qM0H}Bj4^?1ȦgIVz8Q:l[_+ߓBȤl]*s|AqGd[h Ò߂6U4|YGװ q>b]]@#nZrvT(r LJb$B$bC^Ć\T5iBnǚ %}|nLc!jM3w T!fx]cN.Z|Af`(;0Xɴ~uJ&U[ïQ2{X*f8!)1D-7t|U0?/$GzڱX+2sW[G~rᔄzR̴\Ҍ>`hEߣ7Q4N pSHiXb-Ko&߽`q0&w v4d#q\'ӿjLFRR?-Gx0>"u%Q (S~XX/ h[}@IH[2'E"*sԞbyٲP*z x=@2eicЃeFR1_@(L,qXN5wo~[Eorxc7A\LS^w3Nq,S(!YYVr%,gf$UK:gjj&vKc q0rH&$ʌiFe9M9fas刭r* ]9.o3o-Q0';`<|(umz;j"ZPD5JYpoEdbb.{I$`Rjfz$M3=bJpa삋PHUN`ƙ;Sbx\G66yK}ER 7~\Zμ3:ѭX:{ C-Lٹ>?3Xɱh,!dUk?PRH/b~qfSV)ym{?B@r4xg&rIV2B{ù!bklHE#p݊P/l$/vL(A uZkrO%&^o)lFIA+nWm i\$|we?`t Vsjrxخ_7P"ӭv-z,4G'^tEIl56T}ê#?{?g%ċ4?Dl-9Fel+0`W4/wh=ՄxެcEmRŁO _cB$Ce0㋼!xf_+;'GAhuWdwr)Fhޱ o2yxE3;kvur-'b$$ 15o;=@ ;0mbxeKSU(pA/ r8ęsũdP)c)`h8#;#QC^ZEÜbN$wmkTed-i݇ȟ`lL/o+Z;TeILu I 8+/|[;;cO *bH]^RcJ=I&4 _܃F{u뒚J(Fl{jў9/ekůLݓ AFT4bF&ZѬx'!NDsLҡ8'9l\ͥOn_ps\ \To/+,uT Xj?WBgee 9کGL֏Ԍz{8 trp|w#3k .`S |IF{+ud劉XYPy$lQ oWx9쮊8ǜ]Q_V#Ɂ?22b;F'gU"Y;Tp̒`mnPܿRr0ί>|XFٴwGawQlX>NܲWM'aԩw>6~]%L\**8Ms,;.`yÁRFxsu?+)1 ܨs%s{+ry{Pͣ(na5۪Հ}qWvD4ynziV͢Ŷ^ 皱yMH0z\ˏ0`dd4\j2M/U\a:0m[0dt dÐvTQeWȷk3si_ 2 *cwfκEzj ވm {{ک[ ?W+c}&.{S|2ytmu*sV|/.zz?84Ʈcv_ɳ,\ 4H6sI̦Fe E ;*Kk֏#wg\.%4Ǽj"rt L;p05QpјEK@xDKP޶ ę)quSpqCZn;.jL,-XV9-^! .sl7uZ6t΄JCU ~(}D@¢3:6* QYgf|4)ZI39JW7<DA%*%eߔgz8\G|ƾW:fT(e&;e'EkGCe4AT^Z(\ZCL=(Nı֙)l-HZB.*SzO&_ԌD=^ʖ%4R[7% z#\\B5n)~Hӂ}ĭzmWm~ѵ2`R-BCb-1]Gy񲒮q40ɕp[Z!P,3/[v㒺-d+H0(b`TxCvz.ZvzHbܔy53^X#9{( wW_`Rؚ7Я HFo L\"V} R]LknC1C%8+TWu9A Q2xIO`m\qQ_ET{FSJ {1>6Á2BKe @Zj1/y<f[TlSPJ S &Zm#Y%\DrP+TA҅ߧt> #2ڿO\J@ny0T "Dn5PE* [g`lKEscw>`Nq-]ǘ~Ozꘀ܊GN@:HqYB%tȮ& ]sts3rgY瞿zYz'[j޽(#G E NN NG3b[e)sJ,[{'mbzgaFfﰶGF%(+E7 !#fX3) %-mO8Ɲc0IY+\4b厬8 6[[!r|mZdHnmp[PtJ$txUbz&*92''k y'r"XX[l܍gB)N,(9*Q(rc!l j}I#HA/oo 9ans(]sI;a{'m EVwр"sv];W{uRQ!o/t&\4WD&֋mdV@W9/^U~4E=b(5~CKHVQ" Cr%`{3-s*]ua_Rprh\#ƌ糰g@P[A3AXˤHLQDzNxG[c tuF7Ѩ ܢ_>BkA}a,%u>;cN5AND6vVe^tf1rޡ TE# \QY0plUK- ɉ-)aInɏ!?k@ )2v/AJ#mM1S-s Tx}$OvP5߯:)ޟ>RuJrTXG'i[ BۧAҳ^Dt9f*Dڏ`MB=?gBчr~ Khi+fɤсzFF:FO@ҁfZ:U,td@x;%58ލXJcÙ[1^46Y9+ XlU'n5 = in Ӵg[_OA-P?+Sغ4շ Ẹ{j@~7yʬDv} r[H.0+ž ,=9ٔ0^L9okvmH[)uAZFﰨ]* ΣVm \='cZ}>ڝ +ВtD~tSUB5~$Vſ# ^y :AH4|8UgH$M~!`9[2:؛/dJX dHח $-╪Y |18˱J+$$ ˶5NXLK{iQ,_d_̭w5(L9'#H+ph: Å8NL_?ESIrthRdXgc ꇅN.ьp X[S]L kC{_5wc;.Θ &P+yR,\@&UyԿ8joX 9ŕAv7&7L3P]A $ '$D%|EPk*Zq_W"m͛g6Ss-h)*5X!OV^kMFv3H&⮖;ٷ.=#Ȃ̈́Bv1p^jrsV5SE90@#B -g:wT0٢-IJa+bjt ~HAI'+`.1X4_Z[_`,ݫq_ۛ/;ȘrG3{Ƨ(2`κ-aei}TPq*6CmӎA>dT":(1$$jtiBg⨟U:UtMy-n.XJNф ?g1[{,!QC3wt\bO((OwD4\v䈛 :ЕJ'o9CԳcגrϥBj/U./'ĔJF 9|umpEج=G*WĊq&m#ƯbttI3mܐ7O[1~8,kovK\XǀuKR4_YSYwWqr6V:rpxNjNܢsP⋰jbF`2~CiRZ4zt#1T[ݟCjAg -4h/*/yIBiIl}vv+'KIT͎2RʑLk5KM|_Ozi# ^3wYcTl8jBÐtKClxYDvC Q:)Իͱ, s=;'DCc 0#߼"ō8aەt{pgy쯡,ςu /n1s {o\Suv ǃ]u}3pj9<&ȳOJp/LMK _j NʃNvPj qW©f'wAwEH蘏~jz-SAWSwn Hs+QI|NR5YN^oHx__#u/p5팥>P&8{&~i@[NoۺJKP 8e|7J}C®'շ 6#407ۨ:ƤύP`~]F||R8yv=ou&M?)HrwOCB*uBg1KK `>ssiV*@+Ǜb !q ]K= e<7+)E|Z"Tx5{SXJϪ'L.=*@ SS}=4=(pIq8{ .7.%0K;M6'Ξ^Oj?jDZ|_asUvH:~?P}a* p431d9Y`R@bW1M9ǃX}n`] yF?zTR7W=_v162+t1˱/ s>;"^PF{">*Rϲ s3?h~q~1=M̘&w17<b])-Ne;6([eaZaA~F.qciȨOEOG={Hz.Fާ.pGkG`2vKI}2w!вYyrn)~N 7 ?ϙf~y(;,RGCwdOUN,#9?]B hXv*-IҀbv>>Yx‚l{Dzyqp#dOjH[Jݺ"\;^fW5yH8n4,3u{՟z'pMJj=qjMe[Έ!ltM"kf +0cXB̕Φ=N!aPb|iG~9wZ 3@UVd7> u*i C8׽Bi[=ʧj}PߓJA@X[HpZ?qiD!$w1| ʕp,v2~px%'N < P_or#m`Rg&]8fH;  %M i&HN8Rm%B:CQ@Dԣsک&NE1pގ+Mc|{UkfY A_tqL.tW$'ӅRo"J+ȷUW}uȇ#KxVBh43]J&{!#Zj翦|H5)XXyr_P9f!>.g+ ?OA&{õͪ/!C:Ŵ{Mr[o:l%!-WBA./oc*$d^ (yI("(d+.ʑ slq#e]W8]c~!rpGg|.&3]K)?E@ܩg_b0m#դ8}D,^PQt~&ыL^]c,n <νҟ6^IrF ??|sottsÉ=L(͒Cip0UQ8йԖ˪]I%T) {+TA?yD詡µ!fbќT1 Y'y|I 󊒣U9x-V UOm"n)2mKI H?ȉR8 亠7N@O ۿj{rWL5a+2{&EAtJ7l~|P:߷Yۛ$jR- 2ߘfjra~:mw,B@Kzɦ@5$q/ߌ|RDo<>+ƛ\抰Rz\/q _PkfG Ɗ{Vw";#WjNqIs9;BBމIo׵Tuܪ^IȧB"x< "!skW,rpRd*\*o 9P ɸ\k\!I0yܠ)r7hhNf`"AƃrOP2 f>κ~Vw.zSɍIjؠQ湈D+0J.D㪲rL _LB_O;*¯2RՈVm-{a`]%,XŐ κkv荏tcT|MuBpz7Xl&kSt#Aۍb7d-?$#C1Uq]vw: aD.黮RYo oS" .0.Y.w`L2 o'u)Ř>_+Ľ%nUܳy`ϱ/`G3Lz%dO  {Ko/-3im f$sP̍!>+#a`\F{„ak(0X_vRSz@"A:.ƞ[5= ｹU1pNS#x߆*\XfmZ382=ešq-εg6eUsZ+}#; b:^+"ly l7 9@xqvӚ&=2 ت싀r(#&G/z̝gZ˙ )|>ݘ[bPꄜ[8.V/s$Y5}*Dʘ'9ay*)Sb&ϿJh`=wPě{'aGWUVBX3'U ǫBk#W~fAF+Mma/n*n6pI\icn^>V=,Dmuu?ˆvTW{ɗݶU云s`pÜM$pEM*e@l`x9AI(q;UBC/{rT_طŨɦLoS (Cx򢃪yeVξjt$ӌ=s?ޗ~4I~_HG30~' g3X^~6g)>)r,]STfoϮ ^o#N@Yō@} ɡcHL4Mm $71㾅Ͱi)`du_M-.r/hv ЬO΂HO MH[62#CZ$bwBTr-cy$` L_EA#&@$[!H!d2һ*+ΪkO*R'Pj(0:o(waU!_Z4 h4m3hپķ 0-@}uEy -Tm41 ENEr1n#* ŒyjݤP(QzaKʳ2K*xwa CÜ:x&F:Q@nظ$\ @'AAbFky^តZ9:{ mazɎMi!7+ji.W>ځa#.~BC|񇅄L]:I }dM鷎kx-bHr4C%"*zꝸLތ1j#H!O{_+}/lK z~V %}E{$'t`>|-$':q%Tc3DC>ׂ-=$r 󔎢MN#!+23n&+O26P5&^$s~~Յk}Y(9}'+.|N _E.e%}sL++P"κ֘F{@B\ Ǝt,c'ʩ VRPI[x>KP9oWW]!*Rj*,Yp`DcBܰi ^vFEgٟ7¨~ s~6G΁O(17\3S(]{Vz$جJ>7FyY<*iӌ8kC_I~OTzf@nXM4^m/ t2HAN*w_2dpcTp~Νcذ5LI] UJ G#:XD08+ĺI7zss⇃cNӰeT@j#ӾX~ߴA2kCaiNFR$/+%ɸ`!>(VZ{.ހ\lKؓk6w,2irā~Rz}%3SaKP(:ɹQw"o[f;E2"}(ڔU$ZШJ@1\GO;G&5~~,@{#"kƒq$J&b( eX/V!Wm6fDT' išGrE5Pis';+7z=TX ЊS 둙 ғ|ţvdRM8$&.Ve1z(%hP锩[;uo=mLH&O d-v fϸ@PtZ oD/LcEy@QVU6 Y3* 8s;K95:houy ^ ڦywTvXc̀f-$ lBIˮTԏ/~#iU8a}THzE8dUDF \'ުQ{&<ǔP\q+B6yËҬJu]UMpcU:S_>Ux"T2,9| ?Byd{zQB^~\C+Ulق[d>8l2[5 9We;YJ=so6oSX_UlFG꒔CPM!L" Sʡ(\{1"҅#)+{oJ}kws,?.Fp75!);d̒ʽϫ*S?dtPe~v:)YR]{oMD]U|(J']#M;!|Ȋ![q a_e-ꡓ.vS! {"ߏ|0tsW[H*7֢QEkˈn+9*2c߆ g~  aXJ",lZy,/ko:>ANJ!|'\= ]|X%XJI$SG`A+7ʮpQ٘N;!٨O0֪yIڥF<:}~[)( N'䩝BdT5-6"`laesb4KV\1٣-1Q[y$F>υo IQ}Jc.ʨw3.3;zY'gFF}ׇ(tWե,FU,+_ܕT:~0b?ʪ6$͘&U52`nB+uQ g߹ƆTS83g7z1_cf ñv̿?X(ٴ̿PM\-+h"IoDx%ꘛaWHj)!PU$ᛁYhgN?h.MCbY5ɇU#ƙ6 ~4<]Wr޻6*(؞g-}>hsD,#9vd(f$sށ@\2*,oHEXF+H,Q5 |LM6k r^OqDKK7TsALH" STП|g%-Meu++2T*ieMpt뗂+o@,)&m4 4XsjuKjʔ9%i`p'8Jc+:ƒKD׃fJJd4/%3Sq *9`Ȱe&8X'hxY4 ͛_x@|a3!QZviAw8aFzHϰH"[ 槱v#=Cگ%JpuRUL)3v$F-XXyml~)] ˍ[lVh̒79F'IVerQ9FEGNdh(MLi4f8 , 1=8Grq[Nrix#Kn3Ww̋DB!W).u;#3͸$vK)W&y6`sqnE$`b#NB}qm%v׼YwMRxNI;渴!gQ:Da4"-m Oz)\[8= [6yMVGrj=Q^\\i봖+)gGE<:g-N<6=76qMZWS[(B㶜. *`(w士 JfCg%.깷,QB$dCم BNU˽ g{ktJ)_#eR0/?u /^+|,KIVP3Mbѷn1❧6;KMqկ\a| 77C*@'6E#U/88!0C>ፖH(k7{""gZcLr&9 1 _)af_9#L\uϴ6TF~WSe5\Jw~ +B8]/*ջ? ܜ$eH%۽n-.r2 h.6dOe.6 ȵo('XxЃl*S0TGscx5MtX|%M-TE9âȉ4oY|9U8KƐ>DP1 IJK9qӯJWWw_Y8-oAf(FM 3]5 PD3?*5tZ"G(}Öժu{5mp%Q?4jqp6O5H P-C>m#:͝;;-|cSeLSI&O"ns` >⿛ LaQ(euЎ]aJae`P4]XSdYPq+.$9 #Kh'.vWlp&fMZ0e*{Jͦ^ R`oB#$@"C1x~#b!N…T2Y[z]{۩i}MZjȧߓLJTRO!eуx"S3ȧI3;a%e8]U8=zJS~X +tQ]W)*uy?wܤ(U8Sb2jE^DKl,5Ej  @eD2]%|[*IY쳨x?_98v'Ubh ҭ˫ (2|U`^ ĨCږo)Lwݬ屝a?H=z)/NXOLRE~V2} \yP{*r ,>xJ 3Tvk܆iوZ2\INCH1))I]Zݽ7t6}m|{j]Z:A2s wYZ/o,*sfen :h YszF^uBmuf`4Ԓ’ |'HeN-JxYDLJkpQ5J[$JJe7q( Ө3 ḻr5V% ܬ_T}f d? &I"++q}48Y L*M, =("=XjnQ}^kn}RaZ^GF*<h :޳H >P 1_Ѳ rB]wWs+`IByLj&6sэ9hLlO5Gl=6p< Xڃ[]VK.x#7k0W5]͗D$@݀puAҜ'g;?-8 嘰 أrV&NTg@\dM]qRddL.G_d\# /?E^ Hg(h@c\A*X_\堻 "T `QT2dˑ.K`c N^$Ro)ޤXp=Z'ecE_X&3jjrC9l@D ;g]dZ1q?!Nxl f +*S|b2NnzSUK@d&YEhدZ;NÌ҄LPS , <I୑]P-_'.4vrc/)G_lȁxY!ݗP;-J_@߹Fnsh2K;y<6":luD7'9Ő 0(qξyCId1UH^#`rm|Ɩ|a! 90@Hnh ?-CH3hP/4XEXK(9QE)Mo (:T6@bgɥMug% { #\{B$8G,ѿt(u3oT9H:$qIX lNAy0ٯ[b>%Ufq8bҷK*D5ޑ_g˥?Y E)ϓe 28@2a8|ت>U ([YR-q:fQfh6j m_װd!p/ē܄&8?8^B/ts$:g5 07!u %\Iqy1d{^ .wtm5uyu5t&QJdN^l]ZeO 7;\Ê< Å-3b,Ҋ " J  YZ